KEGG   Tribolium castaneum (red flour beetle): 664577
Entry
664577            CDS       T01046                                 

Definition
(RefSeq) myrosinase 1
Organism
tca  Tribolium castaneum (red flour beetle)
SSDB
Motif
Pfam: Glyco_hydro_1 Cellulase
Other DBs
NCBI-GeneID: 664577
NCBI-ProteinID: XP_975666
BEETLEBASE: TC010052
Position
LG7
AA seq 502 aa
MKPIVLLLICASAFALADNPDYHFPDDFVFGAATAAYQVEGAWNEDGKGENIWDRGIHEH
QDWVADKSNGDIACDSYHKYKEDVQLLKNLGVNFYRFSVSWSRILPTGKTDQINQAGIDY
YNNLINELLANGIEPYVTMFHWDLPQPLQDEGGWPERKTADYFVDYAKVLFENFGDRVKH
WMTFNEIMQICEAGYSGGSFAPFIKNPGIGGYECTHTVLLAHGRTYRLYDSDFRGQQQGQ
IGIAVDSYWHEPNYPDRETDQQASEIDMEMNYGWFVNPFVNGNYPDVMIERVKKTSIAEG
YNKSRLPEFTPEEQEMMKGTYDFIGLNHYSSDKVYLADDGAGDHPSHWADTGVIGYQDAS
WPGSASDWLKVVPWGINKLLVWIKNHYNNPPILVTENGFSDYGQLDDYDRANYYKDYLYE
ILKAIHEENCNVIGYTAWSLMDNFEWMAGYTQRFGLHYVDFEDPERPRTRKLSSYVYNNI
VTTRHIDWDYYPDWPPTQDKTQ
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgaagccaattgtgttgctgctcatttgtgcaagtgctttcgcacttgcagacaaccct
gactaccacttccccgatgacttcgtttttggcgctgcgactgccgcctaccaagtcgaa
ggtgcatggaacgaagacgggaaaggtgagaacatctgggacagaggtatccacgagcac
caagactgggtggctgacaagtccaatggagacatcgcctgtgactcgtaccacaagtac
aaggaagacgttcaactcttgaaaaatctgggagttaacttttaccgcttttccgtatct
tggtctagaattcttccaacggggaaaacagatcagattaatcaagcagggattgactat
tacaataacttgataaatgagttgttggctaatgggatcgagccttacgttacgatgttc
cattgggatttaccacagccgctgcaagatgagggcgggtggccggagagaaaaacggcc
gattattttgtcgattatgcgaaagttttgtttgagaattttggggatagggttaaacat
tggatgacttttaatgagattatgcagatttgtgaagctgggtattctgggggtagtttt
gctccttttatcaaaaatccaggaattgggggctacgagtgtacccatacggtacttcta
gcccatgggagaacctaccggttgtacgacagtgacttcaggggacaacagcaaggtcag
atcgggattgcggtcgattcctattggcacgaacccaattatcctgaccgggagactgac
caacaagcttcagaaatcgatatggagatgaattatggatggttcgtcaatcccttcgtc
aatggcaattacccggacgttatgatcgaacgagtgaaaaagaccagcattgctgaagga
tataacaagtcccgcctgccagagtttaccccagaagagcaagaaatgatgaagggaaca
tacgatttcattggtttgaaccactactcttctgataaagtttacctagctgatgacggt
gctggggaccatccgtcccattgggcagacaccggtgtcatagggtaccaagacgcctca
tggccagggtcagcctccgactggcttaaagtcgttccttggggcattaataaactacta
gtgtggattaaaaaccactacaacaacccaccaattctcgtcacggagaacggattttcc
gattatggtcaactcgatgactatgacagagctaactactacaaagattatctctatgag
atactaaaagctatccacgaggaaaattgtaacgttattggatacaccgcctggagtttg
atggacaatttcgaatggatggctggatatacacaaagattcggcttgcattatgtcgat
tttgaggatccagagaggccgagaacgaggaagttatcttcgtatgtttataataatatt
gtgacaacgaggcatattgattgggattattaccccgactggccaccaactcaagataag
acacaataa

DBGET integrated database retrieval system