KEGG   Thermofilum adornatus 1505: TCARB_1713Help
Entry
TCARB_1713        CDS       T03526                                 

Definition
(GenBank) Nicotinamide-nucleotide adenylyltransferase, NadM family
  KO
K00952  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
tcb  Thermofilum adornatus 1505
Pathway
tcb00760  Nicotinate and nicotinamide metabolism
tcb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    TCARB_1713
Enzymes [BR:tcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     TCARB_1713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like HIGH_NTase1
Motif
Other DBs
NCBI-ProteinID: AJB42753
UniProt: A0A3G1A8Q6
Position
complement(1522086..1522613)
Genome map
AA seq 175 aa AA seqDB search
MSCRRALFLGRFQPFHNGHLEALKWILEREPEVVLAIGSAQYSHSFRNPFTVGERLEMIQ
AVLRAENLADRVMVSVVPDTDNEHSLWVRLVVSWSPCFDKVYTNDPLSQLLFREEGFQVE
GIPFHEREVLEGTRIRKLMAEGGDWEKYVHPRVAEIIKRIRGDARIAELYRLSPA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtaggcgtgccttgttccttgggcgcttccagcccttccataacggtcatctg
gaggcgttaaagtggattcttgagagagagcccgaggtggttctggctattggtagtgcc
cagtattcgcatagtttcaggaacccgtttacggttggggagaggctggaaatgattcag
gcagtcctgagagctgaaaatcttgctgacagggttatggtcagcgtggtccccgacact
gacaacgagcattctctctgggtgaggcttgtggttagctggtctccctgcttcgacaag
gtgtacacgaatgatcccttgtcgcagttgctttttagggaagagggtttccaggttgag
gggataccgtttcacgaaagggaggtgctcgagggtacacgtatcaggaagctgatggcc
gagggtggagactgggagaaatatgtgcatccacgggttgcagagataattaagaggatt
aggggtgacgctaggatagcggagttatacaggttgtccccagcctaa

DBGET integrated database retrieval system