KEGG   Theobroma cacao (cacao): 18585803Help
Entry
18585803          CDS       T02994                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00010  Glycolysis / Gluconeogenesis
tcc00562  Inositol phosphate metabolism
tcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    18585803
   00562 Inositol phosphate metabolism
    18585803
Enzymes [BR:tcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     18585803
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     18585803
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 18585803
NCBI-ProteinID: XP_007008879
Position
10
AA seq 475 aa AA seqDB search
MAMAAILLLILALFSNSKADQDFDVRQHLSTVTRYSAVKDIVDDSFLPSDIPDGCTPIHL
NLVARHGTRTPTKKRMRELEKLAAHVQELLKDAKEKNLSLQKVPAWLQKWESPWKGKLTG
GELDIKGEEEMYQLGIRVRERFPDIFNEEYHPDVYPIKTTQVPRASASAVAFGMGLFSGK
GSLGPGRHRAFAVTSESRASDLVLRFFDCCQTYKDFRKNHGPAVDNLKEPILTEITSALA
RRYEFNFTRQDISSLWFLCKQETSLLDITDQACSLFSPTEVALLEWTDDLEVFILKGYGK
SLNYRMGVPLLKDVVQSMEEAIKAKEDNQAPGSYEKARLRFAHAETVVPFSCLLGLFLEG
SDFQRIQKEEPLGLPPKPPQNRNWRGSTVAPFAGNNMLVLYSCPANSSSKYFVQVLHNEH
PTRMPGCGGTDFCPFEVFEERIVRPHLKHDYNTLCNVNLDQPKQKPETTTGTTTF
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggctatggctgctattttgttgctcatcttagcgttgttttcaaattcaaaagctgat
caagatttcgatgtgcgtcaacacctatctactgtaacaagatatagtgcagtgaaagat
attgtcgacgattcctttctaccttctgatattcctgatggatgtactcctatccacttg
aatctcgtggcaagacatggaactcgtactcctactaagaagcggatgagagagttggaa
aagttggctgctcatgtacaagaacttctaaaagacgccaaagaaaagaatttgtccctg
cagaaagttcctgcctggttgcagaaatgggaatctccttggaaaggaaaattgacgggt
ggagaattggatatcaaaggagaagaggaaatgtatcagcttggaatcagggttagggaa
agatttcctgatatatttaatgaggaataccaccccgatgtgtatcccataaagactaca
caggttcctcgggcttctgctagtgctgttgcttttggcatggggctatttagtggcaaa
ggaagtctaggaccagggcgtcatcgagcttttgctgttacaagtgaaagtcgtgcaagt
gatttagttctgaggttttttgattgttgtcaaacctacaaggactttaggaaaaaccat
gggcctgctgttgacaacctgaaagaaccaatcctcaccgaaattacctctgcattagca
agacgatatgagttcaatttcacaagacaggatatatcttctctctggtttctgtgtaaa
caggaaacatccttgttggatataaccgatcaagcttgcagtcttttcagtcccactgag
gttgctttgctggagtggacggatgatttggaggtgtttatattgaagggctacggtaaa
tccttaaattatcgaatgggagtgcctttacttaaagatgttgttcaatccatggaggaa
gctatcaaggctaaagaagataaccaagctcctggcagttacgagaaggcaagactgcgg
tttgcacatgcagaaactgtggttcctttttcatgcttgcttgggcttttccttgaagga
tctgatttccaacgaatacaaaaggaggagcctttgggtctccctccaaagcctccccag
aatagaaattggagaggcagcaccgtggcgccttttgctgggaataatatgctggtttta
tacagttgtcctgctaattcttcaagcaaatactttgtgcaagtcctacacaatgagcat
cccacccgaatgccaggttgtggtggtactgatttctgtccatttgaagttttcgaggag
agaattgtacggcctcatttaaagcatgattacaataccctttgcaatgtgaatcttgat
cagcctaagcagaagcctgaaaccaccacgggcaccactacattctag

DBGET integrated database retrieval system