KEGG   Theobroma cacao (cacao): 18587219Help
Entry
18587219          CDS       T02994                                 

Definition
(RefSeq) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00670  One carbon pool by folate
tcc01100  Metabolic pathways
tcc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    18587219
Enzymes [BR:tcc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     18587219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-GeneID: 18587219
NCBI-ProteinID: XP_017984778
Position
10
AA seq 635 aa AA seqDB search
MSSRSVRKLEVVSPVPADIDIANSVEPFHISEIAKDLNLSSNHYDLYGKYKAKVLLSVLD
ELQGSEDGYYVVVGGITPTPLGEGKSTTTVGLCQALGAFLDKKVVTCLRQPSQGPTFGIK
GGAAGGGYSQVIPMDEFNLHLTGDIHAITAANNLLAAAIDTRIFHESSQSDKALFNRLCP
PNKDGKRKFSDIMFRRLKKLGISKTHPEDLTPEEVKKFSRLDIDPNSITWRRVMDVNDRF
LRKITVGQGPEEKGMVRETGFDISVASEIMAVLALTTSLADMRERLGKMVIGNSKAGDPI
TADDLGVGGALTVLMKDAINPTLMQTLEGTPVLVHAGPFANIAHGNSSIVADKIALKLVG
PGGFVVTEAGFGADIGTEKFMNIKCRYSGLIPQCAIIVATIRALKMHGGGPEVVAGKPLD
HAYVNENVSLVEAGCVNLARHIANTKAYGVNVVVAVNKFSTDTEAEMNAVRNAALAAGAF
DAVICTHHAHGGKGAVDLGVAVQRACENVTQPLRFLYPLDISIKEKIEAIARSYGASGVE
YTEQAEKQIEMCSRQGFSGLPICMAKTQYSFSHIASEKGAPSGFILPIRDVRASIGAGFI
YPLVGTMSTMPGLPTRPCFYEIDLDTTTGKVIGLS
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaagaagtgtgaggaagttggaggtggtgtcaccagtgccagcagacatagat
attgcaaactcagttgaaccatttcatatttctgagattgctaaggatctgaatctcagt
tccaaccattatgatctttatggcaaatacaaagccaaggtgttgttatccgtgcttgat
gagcttcaaggatctgaagatggttattatgtggtggtcgggggaattactccaactcca
cttggagaaggcaagtccactactacagttggtctgtgccaagctttgggtgcttttctt
gataaaaaggttgttacctgtcttcgccaaccatcacaaggaccaacttttggaataaaa
ggaggtgcagctggcggaggctacagtcaggtgatcccgatggatgagtttaatcttcat
ctaactggagatattcatgcaataacagctgcaaacaatctgcttgctgctgccattgat
actaggatttttcatgagtcatcccaatcagataaggctctctttaatcgattatgccca
ccaaataaagatggaaaaaggaaattcagtgatatcatgtttagacgactgaagaagctt
ggcatctccaaaacacatcctgaggaccttacaccagaagaagttaaaaaattttctagg
cttgatattgaccccaattctattacatggagaagagtgatggatgtaaatgatcggttc
ttgaggaaaatcactgttggccagggcccagaagaaaaggggatggtaagggaaacagga
tttgatatttcagttgctagtgagataatggcagttttagccctaacaacatctcttgct
gatatgagagagcggcttggaaaaatggtaattggaaatagcaaggctggtgatcctata
actgctgatgatcttggtgttggaggtgctttaacagtgcttatgaaggatgccatcaac
cctactctaatgcagacccttgagggaacccctgttcttgttcatgctggtccatttgca
aacattgcccatggtaattcttctatcgtggctgataaaattgcattgaagctggtggga
ccaggtgggtttgtggtcactgaagcaggttttggtgctgatattggaacagaaaagttc
atgaatatcaagtgccgatacagtggtctaatacctcagtgtgctattattgtggcaaca
ataagggccttgaaaatgcatggtggtggccctgaagttgttgctggaaagcctcttgac
catgcctatgtaaatgagaatgtttctctggtggaagctggttgcgtgaatttggccagg
catattgcaaacactaaggcttatggtgtaaatgttgttgttgctgtgaacaagttttca
actgatactgaagcagaaatgaatgcagttagaaatgcggcattggctgctggagcattt
gatgctgtaatctgtactcaccatgctcatggtggtaaaggagcggtggaccttggagtt
gctgttcaaagggcctgtgagaatgtgacacagccactgaggttcctatatcctttggat
attagtattaaagagaaaatagaggcaatagcaaggtcatatggtgccagtggtgtcgaa
tacacagagcaggctgaaaaacagatcgagatgtgcagcagacaagggttttctggtcta
ccaatctgcatggccaaaacccagtactcattttcacacattgcctctgagaaaggagca
ccaagcggatttatcttaccaataagggatgtgagagccagcataggagctgggtttatt
taccccttagttggtacaatgagcacaatgccagggctaccaacaaggccttgcttctat
gaaattgatcttgacacaaccactggaaaggttattggtctttcatga

DBGET integrated database retrieval system