KEGG   Theobroma cacao (cacao): 18593244Help
Entry
18593244          CDS       T02994                                 

Definition
(RefSeq) protein IWS1 homolog
  KO
K17498  transcription factor SPN1
Organism
tcc  Theobroma cacao (cacao)
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:tcc03021]
    18593244
Transcription machinery [BR:tcc03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     18593244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 18593244
NCBI-ProteinID: XP_017980114
Position
7
AA seq 324 aa AA seqDB search
MISVMGDNPLCRKDCVMKKQSVVEGKKRERGKEDPEINAMFDAVKRRRKVEKSPEEISLF
VEKVLAELTIVAEDDAQLNREDQPAINKLKKLPFLAEVLSKKSFQLQFLDHGVLTLLKNW
LEPLPDGSLPNANIRGAVLNILADFPIDLEQHYQLEQFKKSGLGRAIMFLSKYDEETVSN
RRVAKDLIDRWSRSIFNKSTRFSDLRNDDIHVPVMKKPVSKPAMMEVKACDLDVSVAKEQ
KLSSRPSSLRQHVTRPEPASLVYTVRPQSKYNPEIARTFARQQRVQGDSRQRIEQRLKQL
KASRKKPLQAAKLSAEGRRVLLSV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtgtgatgggtgacaaccctttgtgccggaaggattgcgtcatgaagaagcag
agcgttgtggaaggaaagaagagggagagagggaaggaggatccagaaatcaatgccatg
ttcgatgctgtcaagaggaggaggaaggtcgagaaaagtccagaagaaatcagcttgttt
gtcgagaaagtactggctgagctcacgatcgttgctgaagacgatgcacaactcaacaga
gaagaccaacctgccatcaacaagctcaagaagttgccatttctcgccgaggttttgtcc
aagaaaagctttcagcttcagttcttggatcatggggttctcacactcttgaagaactgg
ctagagccccttcctgacggcagcctgccgaatgccaatatccgtggagcagttctgaac
atcctggcagattttccgatcgatttagagcaacattaccaactagagcagttcaagaag
agcggccttggaagggcgattatgttcctatcgaaatatgacgaggaaacagtttccaac
agaagggtcgctaaggatttgatagacagatggagccgaagcatcttcaacaagagcaca
aggttctctgacctgagaaatgatgatattcatgttcccgtgatgaaaaagcctgtgagc
aaacctgcaatgatggaagtaaaggcttgtgatttggacgtcagtgttgccaaggagcag
aagctaagttctcgaccatcttctttgaggcaacatgttacaaggcccgaaccagcttca
cttgtttatacagtacgtccccaatctaagtacaacccagagatagccagaacttttgct
agacaacaacgagtacaaggagactctcgccaaaggatagagcagaggttgaagcagttg
aaagcatcgagaaagaagccgctgcaagctgcaaagcttagtgctgagggtcgtcgtgtg
ctcctaagtgtgtga

DBGET integrated database retrieval system