KEGG   Theobroma cacao (cacao): 18597572Help
Entry
18597572          CDS       T02994                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00601  Glycosphingolipid biosynthesis - lacto and neolacto series
tcc00603  Glycosphingolipid biosynthesis - globo and isoglobo series
tcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    18597572
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    18597572
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tcc01003]
    18597572
Enzymes [BR:tcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     18597572
Glycosyltransferases [BR:tcc01003]
 Glycan extension
  P blood group
   18597572
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 18597572
NCBI-ProteinID: XP_007026758
Position
5
AA seq 447 aa AA seqDB search
MSPQKKFSVRSMIGPFRRMSKKSLTYRLISRMAKSPVLSTISLAAILFFIYADSLMSNLS
VHNANIKTGEVFPYTQTQTTPVVEGEGQVATSLNSLPVAAATTIQERKIEETENEDPLIP
PFKASADERMEWFRRKLPELEILKSNELSERFHGRVLELFNNKCSAQFFMVWLSTAQSFG
PREFLAVDSLFSTTPDGCLLILSSSMDSPKGYRILKPLIDRGFNVLAVTPDLPFLVKNTP
AEPWLDDLKSGNMDPGSIPLFNHLSDLIRLAVLYKYGGVYLDTDFIFLKDLSGLRNAIGA
QSINQQTKKWTRLNGAVMIFDIHHPVLVEFLREYATTFNGNRWGHNGPYLVSRVLERLRE
NSEYNITVFPPKAFYPVDWIKIAKLFKKPETEADLKWADDTLADISNDSYVVHLWNKRSR
ELKIEEGSVMARMIAEHCNICENIYDP
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctcaaaagaaattctctgtccgttcaatgattgggccattcagaagaatgtcc
aagaagtcattgacttaccgcttgattagccgcatggcgaagtcgcctgtcttgtccacc
atttcgcttgctgcaatacttttttttatctatgcagacagcttgatgtctaatctatcc
gttcataatgcaaatatcaagaccggtgaggttttcccatatactcagactcagacgact
ccagttgttgaaggagaaggacaagttgccacgagtttgaatagcctgccagtggcggct
gctaccaccatccaggaaagaaagattgaagaaactgagaatgaagatcctctcattcct
cctttcaaagcctcggcagatgaaagaatggaatggttcaggaggaaactaccggaactt
gaaattctcaaatcaaatgagttgagtgagcgattccatggtcgggttttggaattgttc
aacaacaaatgttcagcacagttcttcatggtgtggctgtcaacagcgcagtcctttggg
cctagagagttcttggccgtggatagtctgttcagcaccacccctgatggatgtttgctg
attttgtcaagctccatggacagcccaaaagggtacaggatcttgaaaccacttattgat
cgagggtttaacgttcttgcagtcacaccagacttgccctttctagtcaagaacacccca
gctgaaccgtggcttgatgacttgaagagcgggaatatggaccctggctctatcccttta
ttcaatcatctttctgatctgatcaggctagcagttttgtacaagtatggaggagtttac
ttggacacagacttcatctttttgaaagatttatcagggttgaggaatgccattggtgca
caaagtatcaaccaacaaaccaaaaaatggactcggttaaacggagcagtcatgatcttt
gacatccaccatcctgttttggtggaattcttaagggaatatgccacaactttcaacggg
aacagatgggggcacaatggaccatacttggtttccagggtcttggagagactacgagaa
aactctgaatataacattacagttttccccccaaaggccttctatcctgtggattggatt
aagatagccaagctctttaagaagccagaaacggaggcggacttgaaatgggcagatgat
acactggctgatataagcaatgatagctatgtagttcacctctggaacaagcgaagcagg
gaattgaagatagaggagggaagtgtcatggccagaatgattgcagagcactgtaatatt
tgcgagaacatatacgatccttga

DBGET integrated database retrieval system