KEGG   Theobroma cacao (cacao): 18597714Help
Entry
18597714          CDS       T02994                                 

Definition
(RefSeq) L-type lectin-domain containing receptor kinase V.9
Organism
tcc  Theobroma cacao (cacao)
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_legB Pkinase Pkinase_Tyr Bact_lectin SKG6 APH Insulin_TMD DUF4448 Haspin_kinase Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 18597714
NCBI-ProteinID: XP_007026954
Position
5
AA seq 668 aa AA seqDB search
MFFKKLLLLFLWIKVATSSNQGFIFNGFSLQLVSGQEQSLELGGIAELRTDGLFRLTDSS
TFQVGHVFYSVPFKFKSSPNANAFSFSTTFVFVIVPENSRGHGITFVLAPSKEFGQVAPG
QHLGLFNFSTDGLSSNHIVAIEFDTFQNQEFADIDDNHVGVDINSLKSAKSVSAGSVYSK
TGKYRPADLSCGDRMQVWVEYDGTKHQLNVTLSPVIRRSKPKVPLLSMDIDLSPIILEQM
YIGFSSATGLQVASTYISGWSFQMDGVAKDLDLDKLPSVTRSRKKKSRKKEIIVAVAVPV
VGVLLLAVVFSAIFFLSRKKDRFTEILEDWEVQFGPHRFPYRDLFAATGGFNEKELLGRG
GCGQVYRGELPASKVQIAVKRIFDKSQQRMKEFLAEIGTIGRLRHPNLVRLVGYCRGKDE
LLLVYDYMPNGSLDKYLHNKPEVTLNWSQRFKIIKDVASAVAYLHEEWLEVIIHRDIKAS
NVLLDDDLNGKLGDFGLARCSKHAQETIHLAGTYGYIAPELAKTGRANTSTDVYAFGAFC
LEVVCGRRPLMPRASAEEVHLVDWVFNCWNEGDILKTADPELNKDFAAEEIDLVLKLPLL
CSHTIAAYRPRMSQVISYLNGQASLPEDLDKILHTQELLEQSRDYSLTWTKDSVATMAVT
ESFLFAGR
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgttctttaagaaacttttgctgttgtttctttggatcaaagtggcaacctcaagcaat
caaggtttcatcttcaatggattcagtttacagttggtttctggccaagaacagagttta
gaacttggtggtatagcggaattgagaactgatggtcttttcaggctcacagacagttca
acttttcaggttggccacgttttctattctgtcccgtttaagttcaagagttcaccaaat
gctaacgccttctctttctccaccactttcgtgttcgtcatagttcctgagaactctaga
ggccatggtattacctttgtgcttgctccttccaaggagtttggccaagttgctccaggc
cagcatctgggactttttaacttttcaactgatgggttatcttccaatcatatagttgcc
atcgagtttgacacgttccaaaaccaggaatttgcagatatcgacgataaccatgttggt
gttgatattaacagtttgaagtcagctaaatctgtttctgcaggttctgtttacagcaaa
actggaaaatataggcctgctgatctttcatgtggggacaggatgcaggtttgggtggaa
tatgacggtacaaagcatcaactgaacgtcactttgtctccagtaatccgcaggagtaag
ccaaaagtccctctactgtccatggacatcgatttatcaccaatcattttagaacaaatg
tacattggtttctcttcggccacgggtttgcaggtggcatctacatatatttctggctgg
agcttccagatggatggagtagctaaggatcttgacctggacaaactaccatctgtaact
agatcaagaaagaaaaaatccaggaagaaagaaataatagtggcagttgcggtgccagta
gttggagtacttttgttggcagttgtgttctctgctatttttttcttgtcaagaaagaaa
gacagattcactgagatacttgaagattgggaggttcagttcggacctcataggtttcct
tacagggatctatttgcagcgactggaggcttcaatgaaaaggagcttcttggacgaggc
ggttgtggtcaggtttatagaggagaattacctgcatcaaaagtccaaattgcagtgaag
agaatttttgacaaatctcaacaaagaatgaaagagtttcttgcagagatcggcacaatt
ggaaggctgcgacatcccaatttagtgcgactcgttggttattgtcgaggtaaagatgag
ctccttttggtctatgattatatgcctaatggcagtcttgacaagtacctacacaacaag
ccagaggtaactcttaattggagccaaagatttaaaataatcaaagatgtagcttctgca
gttgcctacctgcatgaagaatggttggaagtcatcattcacagagatatcaaggccagc
aatgtgttattagatgatgaccttaatggaaaattaggtgattttgggcttgcaagatgt
agtaaacatgcacaggaaacaattcatctagctggcacctatggctacatagcaccagag
cttgctaaaactggcagggcaaatacaagcactgatgtttatgcatttggggcattttgc
ctggaggttgtttgtggtagaaggccgctcatgccacgagcatcagctgaagaggtgcat
cttgtggattgggtgttcaattgctggaatgaaggggatatattgaaaacagcggacccc
gaacttaacaaggattttgcggctgaagagattgatctagtattaaagctcccactgtta
tgctcacatactattgcagcatataggccaagaatgtcacaagttatctcatatctgaat
ggccaagcttcactgcctgaagatttggataaaattcttcatacgcaggagctcctggaa
cagtcccgtgattattctttaacttggacaaaggattctgtagcaacaatggcagtcact
gaatcattcctatttgcaggtcgttaa

DBGET integrated database retrieval system