KEGG   Theobroma cacao (cacao): 18597716Help
Entry
18597716          CDS       T02994                                 

Definition
(RefSeq) L-type lectin-domain containing receptor kinase V.9
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
tcc  Theobroma cacao (cacao)
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tcc01001]
    18597716
Enzymes [BR:tcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     18597716
Protein kinases [BR:tcc01001]
 Serine/threonine kinases: TKL group
  IRAK family
   18597716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_legB Pkinase Pkinase_Tyr Pkinase_fungal APH Kinase-like Ntox47
Motif
Other DBs
NCBI-GeneID: 18597716
NCBI-ProteinID: XP_017976163
Position
5
AA seq 722 aa AA seqDB search
MVQGSLTCRKSGPICQRRIQLLPANFLVSQFSLYLLSLNLSIQTKSNQRVPIMCLKDFLV
LFVLIKVAASSNEGFIFNGFSSGLVSGQNKSLELAGVAEVSDGLCRLTNTESFKIGHAFY
SVPFRFKNSSNTNASSFSTTFVFAMVPENFRGHGMAFVLAPSQEFISGQGVASGQHLGLF
NRTNNGNPSNHIVAVELDTFLNQEFGDPNGNHVGIDINSLSSVNLTSANDVPESGLLDPV
DLVSGEGGQLWVEYDGAKHQLNVTLSRFNTSKPEPLLSVDIDLSPFILDQMYVGFSSATA
QLTASSYVLGWSFQIDGKAEDLDLAKLPSVPSASIERSGKKKITLAVGLSIAGVLFVGVI
VSVIFILKRKKDTFVELLEDWEFQFGPHRFAYKDLFIATRGFNEKELLGQGGFGQVFRGE
LPGSKVQIAVKRIFHKSQQGMKEFIAEIGTIGRLRHPNLARLLGYCRSKDELLLVYDFMP
NGSLDKFLYNKPEATLNWNQRFSIIKDVATALAYLHEGWAEVIIHRDIKASNVLLDGEFN
GKLGDFGLARCSKHAQDPQTTHVAGTFGYMAPELAKTGKASTSTDVYAFGAFCLEVTCGR
RPIKQRASAEEVHLVDWVFKCWKEGDILKTADSKLENDFKVGETDLVLKLGLLCSHNVAA
LRPRMSQVILYLRGQASLPENLDPILHTSELVEESSDYSAPSTNDFTRASVTITESFLSR
GR
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagggttctttgacttgcagaaaatctggtccaatatgtcagcgaagaatccaa
ctactacctgctaacttcttagtttctcaattctcactctatctgttgagcttaaactta
tcaattcaaaccaaaagcaatcagagagttccaataatgtgccttaaggattttttggtg
ttgtttgttttaatcaaagtggcagcctcaagcaatgaaggtttcattttcaatggattc
agttcaggactggtctctggccagaataagagtttagaactggctggtgtagcggaagtt
tccgacggtctttgcagacttacaaacacagaatcttttaagattggccacgctttctat
tcggtcccgtttaggttcaagaattcatcaaatactaatgcgtcctctttctctaccact
ttcgtgtttgctatggttcctgagaattttcggggccacggtatggcctttgtgcttgct
ccgtcccaggagtttatatcaggccaaggagttgcatctggccagcatctgggtctattc
aatcgtacaaataatggaaatccatccaatcatattgttgccgtcgagcttgatacgttt
ctaaaccaagaatttggtgatcctaatggtaaccacgttgggattgatatcaatagctta
tcgtcagtgaatttaacttctgcaaacgatgtccctgaaagcggtctattggaccctgtt
gatctggtgagtggagaagggggacaactttgggtggaatatgatggtgcaaagcatcaa
cttaatgtcacgttatctcggtttaacacgagtaagccagaaccgctattgtctgtggat
attgatttatcacctttcattttggatcagatgtatgtaggtttctcttccgccactgct
caactaacagcatctagttatgttttgggttggagcttccagatagatgggaaagcagaa
gatcttgatctggccaaacttccatcggtaccaagcgcaagcattgaaagatctgggaaa
aagaaaataacactagcagtcggactgtcaatagctggagtactttttgtgggagttata
gtctctgtcatttttatcttgaaaagaaagaaagacacatttgttgagttacttgaagat
tgggagtttcaattcggacctcataggtttgcttacaaggatttattcatagcaactaga
ggtttcaatgaaaaggagcttcttggacagggcggttttggacaagttttcagaggggaa
ttacccggatcaaaagtccaaattgcagtgaagcgaatcttccacaaatctcagcaaggg
atgaaagaatttattgcagagattggcacaatcggtaggctgcgacatcccaatttagca
cgactccttggctattgtcgaagtaaagatgagctccttttggtctatgattttatgcca
aatggcagtcttgacaagttcctctacaacaagccagaggccactctcaattggaatcaa
agatttagcatcatcaaagatgtagccactgcgcttgcctacctgcatgaagggtgggcg
gaagtcatcattcacagagatataaaggccagcaacgtgttattagatggtgagtttaat
ggaaaattaggtgatttcgggcttgcaagatgtagcaaacatgcacaggatcctcaaacg
acgcatgtagctggcacctttggctacatggcaccagagcttgctaaaacaggcaaggca
agtacaagcaccgatgtttatgcatttggggcattttgcttggaggtgacttgcggtaga
aggccaatcaagcaaagagcatcagctgaagaagtgcatttggtggattgggtgttcaaa
tgttggaaggaaggtgatatcttaaagacagcagactccaaacttgagaatgacttcaag
gttggggaaaccgatctagtgttgaaacttggactactttgctcacacaatgtggcagca
cttaggcctagaatgtcacaagttatcttgtatctgagaggccaagcttcactccctgaa
aatttggatccaattcttcacacctcagagcttgtcgaagagtccagtgattattctgca
ccatcgacaaatgattttactagagcatcagttactatcactgaatctttcctatctaga
ggtcgttga

DBGET integrated database retrieval system