KEGG   Theobroma cacao (cacao): 18598152
Entry
18598152          CDS       T02994                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00100  Steroid biosynthesis
tcc01100  Metabolic pathways
tcc01110  Biosynthesis of secondary metabolites
Module
tcc_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    18598152
Enzymes [BR:tcc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     18598152
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 18598152
NCBI-ProteinID: XP_007027609
UniProt: A0A061ETG1
Position
5
AA seq 369 aa
MDLGYLLQALIPSWNSVAALAIFFAYLAIAGSILPGKLVPGVTLQDGSRLHYRCNGFLAL
VLLVGLLGIGFKMNFVSPAMISDRGFELLSATLIFSFLVMLVLYAAGCRSGSKGSSLKPH
ITGNLIHDWWYGIQLNPQFLGIDLKFFFVRAGMMGWLLINLSILAKSVQDGSLSQSMILY
QLFCLLYIVDYFVHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLNNKVELT
TAAAIANCFVFLIGYLVFRGANKQKHVFKKNPKALIWGKPPKVIGGKLLASGYWGIARHS
NYLGDLLLALSFSLPCGISSPIPYFYPIYLFILLVWRERRDEARCAEKYKEIWAEYCRLV
PWRIFPYLY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctgggttatcttctacaggccttaattccctcttggaactctgttgctgctttg
gcaatattctttgcttacttagctattgctggatctattttacctggaaaacttgtccct
ggagtcacactgcaagatggctctcgtctccattaccgttgcaatggatttctagctctt
gttttgttagttgggttgctcgggatcggttttaagatgaatttcgtatcacccgcgatg
atatcagacagaggatttgagctgttatcggcaactcttatattcagttttcttgtgatg
ttagtactctatgctgctggctgcaggtctggtagtaaaggttcttcactaaagcctcac
atcacaggaaacctaatacatgactggtggtatggaatacagctgaatcctcagtttttg
ggtatcgatctcaaattcttctttgttagagctggaatgatgggatggctacttatcaac
ctatcaattctagcaaaaagtgttcaagatggctctttgagccaatcgatgattctctac
cagctattctgtctgttatacattgtggactattttgttcatgaggagtacatgacttcc
acctgggacataattgctgagagattgggctttatgttggtctttggagatctagtgtgg
attcctttcacatttagcatccagggttggtggcttttgaataacaaagtggagctgaca
acagctgctgcaatagcaaattgctttgtttttctgatcgggtatcttgtatttagagga
gccaataagcaaaagcatgtattcaaaaagaatcccaaagcacttatatggggtaagcct
ccaaaggttattgggggaaagctgcttgcttctggttattggggaattgcacggcactct
aattaccttggggatttgttgctggcactgtccttcagtttaccttgtggaataagttcc
cccattccatacttctaccctatttatcttttcattctgttggtatggagagaaaggaga
gatgaagcccgctgtgcagagaagtacaaagaaatatgggcagaatactgcagacttgtt
ccatggagaatatttccatatttgtattag

DBGET integrated database retrieval system