KEGG   Theobroma cacao (cacao): 18600075Help
Entry
18600075          CDS       T02994                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00260  Glycine, serine and threonine metabolism
tcc01100  Metabolic pathways
tcc01110  Biosynthesis of secondary metabolites
tcc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    18600075
Enzymes [BR:tcc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     18600075
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_3 Cys_Met_Meta_PP Glyco_hydro_101
Motif
Other DBs
NCBI-GeneID: 18600075
NCBI-ProteinID: XP_007030421
Position
5
AA seq 358 aa AA seqDB search
MVTRMVDLRSDTVTKPTEAMRAAMVTAEVDDDVLGADPTAFQLESEVAKIMGKEAGLFVP
SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGISTIGGVHPRPVKNNEDGTMDINL
IEAAIRDPRGELVYPTTRLICLENSHANSGGRCLSVAYTDRVGELATKHGLKLHIDGARI
FNASVALGVPVHRLVQAADSVSVCLSKGLGAPVGSVIVGSKSFITKARRLRKTLGGGMRQ
VGFICAAAFVALQENVGKLEGDHKKAKVLAEGLNQIKGLRVDVAAVQTNIIYFDIAEGSK
LTAEKLYKNLEEHGVLVMPEGPARMRIVLHHQISSSDVQYTLSCFQQALTGVQEENGN
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggtgaccagaatggtggatcttcgatctgatacagtcacaaaaccaactgaagcaatg
agggctgctatggtaactgctgaagttgatgatgatgttttgggtgctgacccgactgcc
tttcagttagaatcagaggtggcaaagatcatgggcaaggaagctggtctatttgtccca
tcaggcactatgggtaacctcatcagtgttcttgttcattgtgatataaggggaagtgaa
gtcattcttggagacaattcgcatatccatatttatgagaatggtgggatttcaacaatc
ggaggtgtacatccgaggccagtgaagaataatgaagatggaacaatggacatcaatttg
attgaagccgccattagagacccaagaggagagctagtgtacccaactacaaggctgatt
tgcttggaaaattcgcatgcgaactctggtggtagatgcttgtctgtggcatacacagac
agagttggtgagctagccacaaagcatggtctgaagcttcacattgatggggctcgcatt
ttcaatgcatctgtagcacttggagttcctgttcacaggcttgtacaagctgctgattca
gtctcggtatgtctatcaaaaggtctgggtgctccagttggatcagtcattgttggttcc
aaaagctttattaccaaggctagaagacttcggaaaaccttaggtggtgggatgaggcag
gttggttttatttgtgctgctgcttttgttgctttgcaagagaatgttggaaagcttgag
ggtgatcataagaaggcaaaggtgttagcagaggggctaaatcaaattaaaggtctaaga
gtggatgttgctgctgtgcaaaccaatatcatatattttgacatagcggagggatcaaaa
ctcacagcagagaaactatacaagaacttggaggaacatggtgtccttgtgatgccagag
ggcccagccaggatgagaattgtccttcaccaccaaatttcatcaagtgatgtgcaatac
actttgtcatgctttcagcaagctttaactggagtgcaagaagaaaatggaaactaa

DBGET integrated database retrieval system