KEGG   Theobroma cacao (cacao): 18602784Help
Entry
18602784          CDS       T02994                                 

Definition
(RefSeq) 9-cis-epoxycarotenoid dioxygenase NCED6, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00906  Carotenoid biosynthesis
tcc01100  Metabolic pathways
tcc01110  Biosynthesis of secondary metabolites
Module
tcc_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    18602784
Enzymes [BR:tcc01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     18602784
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 18602784
NCBI-ProteinID: XP_017974351
Position
4
AA seq 606 aa AA seqDB search
MQASVHLFTTTPPTPKHQNLFQAQYPSFTCKILINPSKKITPRNPSPLFPPPPSRSPLYP
EVEPIVKPERVLVPHEANYPVHLNPLQKLAALALDQIETSVIKPLEKNHDLPKTVDPAVQ
ISGNFAPVQECSVQHGLEVVGQIPACLRGVYVRNGANPMFAPSGGHHLFDGDGMIHAVSL
GRGNEASYSCRYTRTSRLMQEARLGRSIFPKPIGELHGHLGLARLALFMARAGVGLVDGS
HGTGVANAGLVYFNGRLLAMSEDDLPYHVKINADADLETMGRFNFDDQIDCPLIAHPKVD
PVTGEFHTLNYNVLKKPYLKYFKFDKFGKKSRDLHVSIEQATMIHDFAITENFVVIPDHQ
VVFKLSEMIRGGSPVLYDKKKTSRFGILQQNDVDGSNIQWIDVPNCFCFHLWNAWEEHSD
NGHKIIVVIGSCMSPPDSVFNESKDPFRSELSEIRLNLRTGESTQRVVISGTNLEAGQVN
RQYQGRKTRFVYLAIAEPWPKCSGITKVDLETGEVTKFMYGACRFGGEPFFVPEKKQKHG
GNIANEAEDEGYIMGFVRDEKKEISELVIVKALSMEQVAAIRLPTRVPYGFHGTFVSEEE
LSRQVM
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcctccgttcacttgttcaccaccactccaccaaccccaaagcatcaaaatctc
tttcaagctcaatacccatcatttacatgcaaaattcttattaatccttccaaaaaaata
actcctcgaaatccatcaccgttgtttccaccaccaccatcacggtcacctttgtatcct
gaggttgaacctattgtcaagcctgaacgtgtcttggttccacatgaagcaaactacccg
gttcacttgaacccattgcaaaagttagcagcgttagcgttggaccaaattgagacttca
gtgatcaagccactagaaaaaaaccatgacttgcctaagacggttgacccagcggttcaa
atatcaggcaactttgcgccggttcaagagtgttcagttcagcacgggttggaagtggtg
ggccagattccagcttgcctacgtggcgtctatgtccgaaacggtgccaatcctatgttt
gcaccctcaggtggacaccatttgtttgacggtgatgggatgatccatgccgttagcttg
gggcgtgggaatgaagctagttacagctgtagatatactcgtaccagccggctcatgcaa
gaagccaggttgggtcggtctatatttcctaaaccaattggtgagctgcatgggcacttg
ggtttggctcggttagctttgttcatggctcgagctggtgttggactggttgatggttca
catggcacgggagtggcaaatgccgggcttgtttacttcaatggtcgattgttagccatg
tccgaagatgatcttccttatcatgttaaaatcaatgctgatgctgatcttgaaactatg
ggacggttcaattttgatgatcaaattgattgtccattgattgctcaccccaaagtagat
cctgttacaggtgagtttcacactctcaattacaacgttttaaaaaaaccttacttgaaa
tatttcaagttcgataaattcgggaaaaagtcacgtgacttgcacgtgagcatagagcag
gcaacaatgatacatgactttgctataacagagaattttgtagtgatcccggatcatcaa
gtggtattcaagttatccgaaatgattcggggcgggtcacccgttctatatgacaaaaag
aagacatctcgatttggaattttgcaacaaaatgacgttgatggatcaaatatccaatgg
attgacgtaccgaattgcttctgtttccatttatggaatgcatgggaagaacattctgat
aatggtcataaaatcatcgtcgttatcggatcctgcatgagcccgcccgactctgttttc
aacgagtccaaagacccgttccgaagtgaactatccgaaatccggttgaacttaagaaca
ggagagtccacacaaagggttgttatatcaggcacgaacttggaagcagggcaagtgaac
cggcaatatcagggtcggaagacccggttcgtgtacctggcaatagcagagccatggcca
aagtgttctggtattactaaagtcgatttggagacaggagaagttaccaagttcatgtac
ggtgcatgccgttttgggggtgagccattttttgtgcctgaaaagaagcagaaacatgga
ggcaatattgctaatgaagctgaagatgaaggatacataatggggtttgtgagagatgag
aagaaggagatttctgagctggtgatagtgaaagctttgagcatggagcaagtggctgca
ataaggctgcccacaagggttccatacgggtttcatggcacgtttgtcagtgaggaagag
ctcagccgacaagtcatgtga

DBGET integrated database retrieval system