KEGG   Theobroma cacao (cacao): 18602835Help
Entry
18602835          CDS       T02994                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00480  Glutathione metabolism
tcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    18602835
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tcc02000]
    18602835
Enzymes [BR:tcc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     18602835
Transporters [BR:tcc02000]
 Other transporters
  Pores ion channels [TC:1]
   18602835
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_C_2 GST_N_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 18602835
NCBI-ProteinID: XP_007034525
Position
4
AA seq 224 aa AA seqDB search
MAEVQLVGSWASVYVFRVIWGLKLKGVAYEYFEEDLSNKSPLLLQSNPVHKKIPVFIHGG
KPICESMIILEHIEEAWPHNPLLPTDPFDKATARFWIKFAEDKIAATVWPLYRTEGEEQE
KAVKESLEMLQTIEEHALGVGDEKKFFGGDKINMVDIAFGGIAHWLGIIEDVAGMKLVEP
HKFPRLSQWIENFKQVPVIKENLPDRDATFAYLKRRREMLLASK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtgcagcttgtcggctcatgggctagtgtttatgtctttagagttatttgg
ggcctgaaactaaagggggtggcatacgaatactttgaagaagatctctccaataagagt
cctctgcttcttcagtccaacccagttcacaagaagatacctgttttcatccatggtgga
aaacccatttgtgagtccatgattattcttgaacatattgaagaggcttggccacataat
cccttgctgccaaccgatccctttgacaaagccactgctcgattttggattaaatttgca
gaagacaagattgcagcaacagtttggcctctttatcgaacggaaggcgaagaacaagag
aaggcagtgaaagagagcttggaaatgctgcaaactatcgaagaacatgcccttggggtt
ggggatgagaagaagttcttcggaggagacaagattaatatggtggacatagcctttggt
gggatagctcattggctgggaattattgaagatgtagcaggaatgaagctagtcgaaccc
cacaagttccctcgcctgagtcagtggatcgaaaacttcaaacaagttcctgtaatcaaa
gaaaacctccctgaccgtgacgcaacgtttgcttacttgaagcgtcgccgggaaatgctg
cttgcatccaagtga

DBGET integrated database retrieval system