KEGG   Theobroma cacao (cacao): 18605071Help
Entry
18605071          CDS       T02994                                 

Definition
(RefSeq) beta-glucosidase 13
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00460  Cyanoamino acid metabolism
tcc00500  Starch and sucrose metabolism
tcc00940  Phenylpropanoid biosynthesis
tcc01100  Metabolic pathways
tcc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    18605071
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    18605071
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    18605071
Enzymes [BR:tcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     18605071
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 18605071
NCBI-ProteinID: XP_017972673
Position
3
AA seq 533 aa AA seqDB search
MLPLSSFSIASAQQSLIWISAFALLACLSVHGQITQASQEGVDATLSNSGEYLNVKRSHF
PRDFVFGASTAAAQIEGSTTFGGRGPSVWDEFVRKFPDRIIDKSNLEVAIDSYKRYKEDA
LALKDLGVDAYRFSIPWTRILPDGSLSGGINQEGINHYNSLINELVKHGIKPFVTLFHFD
SPEALEEKYGGFLNRTIVKDFKDYAEICFKTFGDRVKNWITINEPLVIAKFGYGLGMAPP
GRCSDRKACPAGNAATEPYIAVHNLLLAHATVARLYKEKYLAAQGGQIGLSLVGQYYEPY
SNTLFDRVAAKRAMDFELGWFMEPLVRGEYPLSMRRLVKDRLPVFSAKEKELVKGSFDFI
GINYYTARYAKNIPINPQAAPISYSADQHVNATVDKDGVLIGPSAGGSMFIYVYPKGLYK
ILKFMTKHYNKNLTIYITENGFTEKNDDSIPIHQAINDQPRIEFVQKHLQQLRRAINIDV
NVKGYFYWSLFDNFEWTEGFSVRYGLYYVDYKNNLKRIPKKSATWYHDFVKGP
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgttgccactttcatcattttcgattgcatcagctcagcagagtctcatctggatctct
gcctttgctttgcttgcctgcttgtctgtgcatggccaaataactcaagcatcccaggaa
ggggtagatgcaactttatcaaactctggggaatatttgaatgtcaagagatcccatttt
ccaagagattttgtttttggagcatccactgctgctgctcagattgaaggatcaactaca
tttggagggagaggaccgagcgtttgggacgaatttgttcggaaattcccagacagaata
atagacaagagtaacttggaggtagcaatcgactcttataaacgctacaaggaagatgcc
ttggctttgaaggacctaggcgtcgatgcttatagattttccatcccctggactaggatt
ttaccggatggatctttgagtggtggaataaatcaggagggcatcaatcactacaacagt
ctcatcaacgagttggttaaacatggcatcaagccctttgtgacactatttcactttgac
tcaccggaagcccttgaagagaagtacggaggcttcttaaaccgcactattgtgaaggat
ttcaaggattatgctgaaatttgttttaaaacatttggagatcgcgttaaaaattggatt
accatcaatgaaccactagttattgctaaattcgggtatggcttgggaatggctccacca
ggcagatgttcagatagaaaagcgtgtcccgctggcaatgcagccactgaaccttacatt
gctgtccacaaccttcttcttgcccatgcaactgttgctaggctttacaaagagaagtac
ctggcagcacaagggggacaaattggattgagccttgttgggcagtattatgagccctat
tcaaacacattgtttgatagagttgcagcaaaaagagccatggatttcgagttgggatgg
tttatggaacccctggtgcgaggagagtaccctctgagcatgagaagattggtgaaggat
aggctacccgttttcagtgcaaaagagaaagagctggtcaaaggatcttttgatttcatt
ggcatcaattactataccgcaagatatgctaagaacattccaattaatccacaagctgca
cccatcagctactcagcagaccaacatgtcaatgccacagtggacaaagatggagttctt
attggtccaagtgctggagggagcatgttcatttacgtttatccaaaagggctgtacaaa
attttgaagttcatgacgaaacactacaataaaaaccttacaatctacattaccgagaat
ggtttcacggagaaaaatgacgacagcattccaattcatcaggcaataaatgatcaacct
agaattgaatttgttcagaaacatttgcaacaactccgcagggcaatcaacattgacgtg
aatgtcaaaggatatttctattggagtttatttgataactttgaatggacagaagggttt
agcgtccgatatggactttactacgttgactacaagaacaacctcaagcgcatccccaag
aaatctgccacatggtaccatgattttgtcaaaggtccctga

DBGET integrated database retrieval system