KEGG   Theobroma cacao (cacao): 18605999Help
Entry
18605999          CDS       T02994                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK10
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
tcc  Theobroma cacao (cacao)
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tcc01001]
    18605999
   01009 Protein phosphatases and associated proteins [BR:tcc01009]
    18605999
Enzymes [BR:tcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     18605999
Protein kinases [BR:tcc01001]
 Serine/threonine kinases: Other
  Wnk family
   18605999
Protein phosphatases and associated proteins [BR:tcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     18605999
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C APH
Motif
Other DBs
NCBI-GeneID: 18605999
NCBI-ProteinID: XP_007039430
Position
3
AA seq 620 aa AA seqDB search
MEAADDCDLAEKDPSGRYVRYDEILGKGAFKTVYKGFDEADGIEVAWNQVNIEDVLQTPE
QLERLYSEVHLLKSLKHENIMKFYNSWVDDKNKTINMITELFTSGSLRQYRKKHKNVDMK
AIKNWARQILRGLHYLHSHNPPIIHRDLKCDNIFVNGNNGEVKIGDLGLATVMQKPTARS
VIGTPEFMAPELYDEEYNELVDIYSFGLCMLEMITCEYPYNECKNPAQIYKKVTSGVKPA
SLGKVNNPQVKQFIEKCLLPASMRLPAVELLKDPFLLAETPKEVACGPLQLPNLMPKLVN
LIQSEPLPMDIDPNSKKLQVNSSTKSIKETSRISTLELQCFTESNEFMLKGEKNDDNTIS
LTLRIADQCGRARNIHFSFYLDSDTAISIAAEMVEQLDLSNEDVTDIAELIDSMIMKFVP
CWKPSFGSISCLQDGSCCPSKATVKTVGKQEAFTDFAVVKCQDTQESVSSDMSAECDGMV
ASDGSNNKPMGSSGYSYGECHKGSSTYDFGLLDIGVYNHPRHKETGNEENLGESVLINDS
TKNSETSLMDSCSFASQDMSLSSICSLSLADKDQVDELKLELDAIDTQYHQCFQELMRMR
EEAMENAKKRWITKKRVSVV
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggctgatgattgtgatctcgctgagaaagatccgtcgggtcggtacgttcgg
tatgatgagatcctggggaagggagctttcaagactgtttataagggatttgatgaagct
gatggaatagaggttgcatggaaccaagtcaatattgaagatgtcttgcagacgcctgaa
cagttggaaaggttatattcagaggttcatcttttgaagtcattgaaacatgaaaatatt
atgaagttctacaactcctgggtggatgataagaacaagaccattaacatgataacagag
ttgtttacttcggggagtttgaggcaataccgtaagaagcataagaatgttgatatgaag
gccatcaagaactgggcacggcagatccttagagggttacactatctgcatagtcacaat
cctccaatcattcatagagatttaaaatgtgataatatatttgtaaatggaaataatgga
gaagtcaagatcggagaccttggtttggcaactgtcatgcagaagcccactgcccgaagt
gtgattggcactcccgaattcatggctccagagctttatgatgaggaatataatgaactt
gttgacatctattcttttggtctgtgcatgttggagatgattacttgtgaatatccatat
aatgaatgcaaaaatccagcacaaatatataagaaagttacctctggtgttaaacctgct
tcccttggtaaagtgaataatccccaagttaagcagtttattgagaaatgtcttcttcca
gcatctatgagattgccagctgtggagctcttgaaagatccattccttttggctgaaact
cctaaggaagttgcctgtggtccactgcagttaccaaatcttatgcccaaattagttaat
ttgatccagtctgaacctcttccaatggacatagatcctaactccaaaaagcttcaggtc
aattcttctacaaaaagcatcaaagaaacttctcgaatttcaactcttgagctacagtgt
ttcactgagagtaatgaatttatgttgaaaggggagaaaaatgatgataatacaatttca
ttgaccttgcgcattgctgatcaatgtggtcgagcaaggaatatccatttttccttttat
cttgattctgatactgctatttcgattgctgcggagatggttgaacaacttgatttgtca
aatgaagatgtaactgacattgcagagttgattgatagcatgataatgaagtttgtaccc
tgctggaaaccttcatttggaagcatttcatgtctacaagatggctcatgctgccctagc
aaggccactgttaagacagttggtaagcaagaagctttcacagactttgctgttgtgaaa
tgccaagacacccaagaatctgtcagttcagatatgtcagctgaatgtgatggaatggtg
gcctcggatggtagtaacaacaaaccaatgggatcttctggttacagttatggtgagtgc
cataaaggttctagcacatatgattttggtttattagatattggtgtttataaccatcct
aggcataaagagactggtaacgaggaaaaccttggggaatctgttctgataaatgactcc
acaaagaactccgagacatctttaatggattcttgttcttttgcatcacaagatatgagc
ttgtcgagcatctgctctctatccctagcagacaaggatcaggttgatgagctgaagttg
gagcttgacgcaattgatacacagtatcaccagtgtttccaagagctcatgaggatgaga
gaagaagcaatggagaacgccaagaaaaggtggataacaaagaagagagtatctgtggtg
tga

DBGET integrated database retrieval system