KEGG   Theobroma cacao (cacao): 18606831Help
Entry
18606831          CDS       T02994                                 

Definition
(RefSeq) transcription factor IWS1
  KO
K17498  transcription factor SPN1
Organism
tcc  Theobroma cacao (cacao)
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:tcc03021]
    18606831
Transcription machinery [BR:tcc03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     18606831
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26 baeRF_family3
Motif
Other DBs
NCBI-GeneID: 18606831
NCBI-ProteinID: XP_017973717
Position
3
AA seq 493 aa AA seqDB search
MDSYRDEEGEPIMDYDDIQSDPGSPEPRQDLLDDVEDDMEDWGRRERSQTPVYDTDKVGK
PRKRLVKKGGSMGKESMDAPELLDEDEDANFGREGSESDARKRKKKEKSLKEKKYGGGGE
KGTVTKLGKSEEVNEMWEWVNPENDQEGVRTMDDDDFIDDSGVDPADRYGSDNEARSPGD
APQAEEDGEDPEIKDLFKMGKKRKKNEKSPAEIALLVENVMAELEVTAEEDAELNRQGKP
AINKLKKLPLLTEVLSKKQLQPEFLDHGVLTLLKNWLEPLPDGSLPNINIRAAILRILTD
FPIDLEQHDRREQLKRSGLGKVIMFLSKSDEETTSNRKLAKDLVDKWSRPIFNKSTRFED
MRNIDDDRVPLRRPSVKRPANRAAAMESRDGDFDLDISRDHKSGRSSSGQHASRTESSSR
LHASRPEATPMDFVVRPQSKIDPDEIRARAKQVVQDQRRQKMSKKLLQLKAPKKKQLQAT
KLSVEGRGMLKYL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggattcttatcgcgatgaggaaggagagccgattatggactatgacgacattcaatcc
gaccccggttctccggagccgcgacaagaccttcttgatgacgtggaggatgacatggag
gattggggccgacgagaacggtcgcagacgccggtttacgatactgataaggtcgggaag
ccgagaaaaagactggtcaagaaagggggctctatgggaaaagagagtatggatgcccct
gagttgttagatgaagatgaagatgccaattttgggagggaaggatcggagtcggatgcc
aggaagaggaagaagaaggagaagagtctcaaggagaaaaagtatgggggtggtggtgaa
aaaggaactgttacgaagttggggaagtcagaggaagtgaatgagatgtgggagtgggtt
aatcctgagaatgatcaagagggtgttaggactatggatgatgatgacttcatagatgac
agtggtgttgaccctgcagacagatatgggagtgacaatgaagcaaggtcacctggtgat
gcccctcaggcagaggaagacggtgaggatcctgagattaaggatttattcaagatgggt
aaaaaaagaaagaagaatgagaaaagccctgcagaaattgcattactggttgagaatgtt
atggctgagcttgaggtaactgctgaagaagatgcagagcttaatagacaagggaagccc
gcgattaataaactcaagaagttgccacttcttactgaggttctctcaaagaagcagctt
caaccagaattcttagatcatggagttttaaccttgttgaagaattggctcgaacccctt
cctgatggaagcttaccaaatataaatatccgtgcagcaattttgaggatattgactgat
tttccaattgatctagagcagcatgatagaagggagcaactaaagaggagtggtcttgga
aaggtgattatgtttttatcaaaatctgatgaggaaaccacttccaacagaaaacttgct
aaggatttggtcgataaatggagtagaccaatctttaataagagcacaaggtttgaggac
atgagaaatattgatgatgatagggttcccttgcgaaggccttctgtgaaaagacctgca
aatagagctgctgcaatggaatctagagatggtgattttgatttggatatttctcgagac
cacaagtctggtcgatcatcatcaggtcaacatgcttcaaggacagaatcttcttcaagg
ctgcatgcttcaaggccagaagcaacgccaatggattttgttgtgcgtccccagtctaag
attgatccagatgaaattagagcacgtgcgaaacaagttgtacaagatcagcgtcgtcaa
aagatgagtaagaagttgctgcagttgaaggcaccaaaaaagaagcagttgcaggctact
aaacttagtgttgagggtcgtggtatgctcaaatacctgtaa

DBGET integrated database retrieval system