KEGG   Theobroma cacao (cacao): 18607063Help
Entry
18607063          CDS       T02994                                 

Definition
(RefSeq) tyrosine/DOPA decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00350  Tyrosine metabolism
tcc00360  Phenylalanine metabolism
tcc00380  Tryptophan metabolism
tcc00950  Isoquinoline alkaloid biosynthesis
tcc00965  Betalain biosynthesis
tcc01100  Metabolic pathways
tcc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    18607063
   00360 Phenylalanine metabolism
    18607063
   00380 Tryptophan metabolism
    18607063
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    18607063
   00950 Isoquinoline alkaloid biosynthesis
    18607063
   00965 Betalain biosynthesis
    18607063
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tcc04147]
    18607063
Enzymes [BR:tcc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     18607063
    4.1.1.105  L-tryptophan decarboxylase
     18607063
Exosome [BR:tcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   18607063
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 18607063
NCBI-ProteinID: XP_017970285
Position
2
AA seq 517 aa AA seqDB search
MGSLESIVNLENNSSDIVNPLNPDEFRRQGHIIIDFLADYYQNIEKYPVLSQVEPGYLRK
LLPMSAPYIAEPVEAILQDVEKHIIPGITHWQSPNYFAYFPSSGSVAGFLGEVLSTGFNV
VGFNWISSPAATELESIVMDWLGQMLELPQRFLFTGNGGGVIQGTTCEAMLCTLTAARDQ
MLSKIGRENIGKLVVYGSDQTHSAVAKAAKIVGIDPKNFRAIKTNKSTSFGLSPESLRIA
ITKDVKTGLIPLYLCATVGTTSTTAVDPLRPLCDVAKEYGVWVHVDAAYAGSACICPEFR
HFINGVEGANSFSLNAHKWFFTTLDCCCLWVKDPSTLTKSLSTNPEYLKNKASDSKQVVD
YKDWQVTLSRRFRAMKLWLVLRSYGVANLRNFLRSHVKMAKRFEELLASDNRFEVVVPRY
FATVCFRVLPSALCKIQNEPCGKADHHVHQKHANEFNRKLLESINASGHMYMTHAQVEGI
YMIRFAVGATLTEDKHVTKAWEVVREMVDTMLKLHPQ
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgggtagccttgaatccatcgttaatctagaaaacaattcttccgacattgttaaccct
ctgaatcctgatgaatttaggaggcaaggccacataatcatagatttcttagctgactat
taccaaaacattgagaaatacccggttttaagtcaggttgaaccaggctaccttcggaaa
ctcttgccaatgtccgccccatatattgctgaacccgttgaagcaatccttcaagatgtt
gagaaacatataatccctggtataacgcactggcaaagtcctaactattttgcatacttc
ccatcaagtggcagcgttgctggcttccttggggaggtgcttagcaccggtttcaatgtg
gtgggattcaattggatatcatcaccagctgcgacggagcttgaatccatagtcatggat
tggcttggtcaaatgcttgagcttcctcaaaggttccttttcactggaaatggagggggt
gtgatacagggaactacttgtgaggccatgttgtgtacactaacagcagcaagagatcaa
atgttgagcaaaattgggagggagaatattgggaaattagttgtctatgggtcggaccaa
acacatagcgctgtagcaaaggcagctaaaattgtgggtatcgaccctaaaaattttcgg
gcgatcaagacaaacaaatcaacatcatttggtctgtcaccagaatcattacgaattgca
ataactaaggatgtcaaaacaggactgatcccactatatctatgtgccacagtggggaca
acatcgaccactgctgttgatccattaaggccgctgtgtgatgtggcaaaagaatatgga
gtgtgggttcatgtcgatgctgcttatgcaggaagtgcctgtatttgccctgagtttcga
cattttatcaatggtgtggaaggtgcaaactcttttagtcttaatgctcataaatggttc
ttcaccactttggattgctgttgtctttgggtgaaggatccaagcactcttacaaaatct
ctctcaacaaacccggaatacctgaaaaataaagcaagtgattcaaagcaagtggtagac
tacaaagattggcaggtaactcttagcagaaggtttcgagctatgaaactttggcttgtg
cttagaagttacggtgtggccaatcttagaaactttctgagaagccacgttaaaatggca
aaacgtttcgaagagctcctggctagcgacaacaggtttgaggtggtagtacccaggtat
tttgctacggtctgtttcagggttttgccatccgctctgtgtaaaattcagaatgaacct
tgcggtaaagctgatcatcatgtccatcagaagcatgcaaacgagtttaacagaaaattg
ttagagtcaatcaacgcatcggggcatatgtacatgactcatgctcaggttgagggaatt
tatatgataagatttgccgtcggcgccactcttacagaggataaacatgttaccaaggct
tgggaggtggtgcgagagatggtggataccatgcttaagctccatccacagtaa

DBGET integrated database retrieval system