KEGG   Theobroma cacao (cacao): 18607106Help
Entry
18607106          CDS       T02994                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00511  Other glycan degradation
tcc00600  Sphingolipid metabolism
tcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    18607106
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    18607106
Enzymes [BR:tcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     18607106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N EF-hand_5
Motif
Other DBs
NCBI-GeneID: 18607106
NCBI-ProteinID: XP_017970912
Position
2
AA seq 952 aa AA seqDB search
MSERKILDNGFDEGDKDASNHSINKVDPRKPAPLTWNRKLNGEGYVPSMFTLTFQEKLHM
APIGIRLLQHIREQSTKGRRVFINPFAKRYITSCHGVPLGGVGAGSIGRSYKGEFQRWQL
FPRICEEKPVLANQFSVFVSRSNGEKYSSVLCPASPELLKENAVSGIGSWDWNLKGNNST
YHALYPRAWTVYEGEPDPELKIVCRQISPVIPDNYKESSFPVSAFTFTVYNTGKTTADVT
LLFTWANSVGGVSEFSGRHSNSKIMMKDSVHGILLHHMTADGLPPVTFAIAAQETDGVRV
SECPCFLISGNSQGITAKDMWQEIKEHGSFEHLKSTDASVPSEPGSSIGAAIAASLTIPS
DAVRTVTFSLAWDCPEVDFLGGKTYHRRYTKFYGTDGDVAANIAHDAILGHSHWESLIEA
WQRPILEDKRLPEWYPVTLFNELYYLNSGGTIWTDGSPPVHSLVSIGGRKFSLDRSQLGL
KSIIDVPHQNGTAIDILGRMTSILEQIHTPIASNSAFGTNLLQEGEENIGQFLYLEGIEY
HMWNTYDVHFYASFALIMLFPKLQLSIQRDFAAAVMMHDPSKMKLLHDGQWVPRKVLGAV
PHDIGIDDPWFEVNAYCLYDTDRWKDLNPKFVLQVYRDVVATGDKRFAEAVWPSVYVAMA
YMDQFDKDGDGMIENEGFPDQTYDTWSVSGVSAYSGGLWVAALQAASALAREVGDKGSED
YFWFKFLKAKAVYQKLWNGSYFNYDDSGSRTSSSIQADQLAGQWYARACGLLPIVDEDKA
RSTLEKIYNYNVLKVKDGKRGAVNGMLPDGRVDMSSMQSREIWSGVTYAVAATMIHEDLV
DMAFHTAGGIFEAVWSEKGLGYSFQTPEAWNVDDQYRSLAYMRPLAIWAMQWALSRQKLP
KQEPKPELKADSLRIHHAGFSKVARLLKLPEEQGTRSLLQVMFDYTCKRMLI
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagagaaagatcttggataatggttttgatgaaggagataaagatgcatccaat
cattcaataaataaagttgaccccaggaaacctgcaccactaacttggaatcgaaaacta
aatggtgagggatatgttccttcaatgttcactctgacgtttcaggagaaacttcatatg
gctcctataggtattcggcttttgcagcatatccgagaacaatcaaccaaaggaaggcgg
gtttttatcaacccatttgctaagcgctatatcacatcttgtcatggtgttcctctaggt
ggtgtcggcgccgggagcattggaagaagttacaaaggtgaatttcagcgctggcaacta
ttccctagaatatgtgaagagaaaccagttttagcaaatcagttttctgtttttgtttcg
cgctccaatggtgagaagtattccagtgtactgtgcccagcaagtcctgagctgcttaaa
gaaaatgcagtctcaggaattggttcttgggactggaatctgaagggtaataattccaca
tatcatgctttatacccaagggcttggacagtatatgaaggtgaacctgaccccgaactt
aaaattgtttgtcgccaaatttcacctgttattcctgataattacaaagaaagcagcttt
cctgtttcagcttttactttcactgtatataatactggaaagaccactgcagatgttacc
ttgcttttcacttgggctaattctgtgggaggagtttctgaattttctggtcgtcactcc
aattcaaaaataatgatgaaggatagcgtgcatggcatccttttacatcacatgactgca
gatggactacctcctgtgacttttgcaattgctgcacaggagactgatggtgttcgtgtt
tcagagtgcccctgctttttgatatcagggaactcacaaggcataactgcaaaagacatg
tggcaagaaataaaagagcatggctcctttgagcatttaaagtccactgatgcatcagtg
ccttcagagccgggttcctctattggggcagccattgcagcttctctgacaattccatct
gatgctgtacgcactgttactttttcattggcatgggactgtcctgaggtagactttctt
ggtggaaagacttatcacaggcgttatacaaaattctatggaaccgatggggatgttgca
gcaaatatcgcacacgatgctattcttgggcacagtcattgggagtcactgattgaagca
tggcaaaggcctatactcgaagacaagaggcttcctgaatggtaccctgtcactttattc
aatgagctctattatcttaattcagggggaacaatttggacagatggatcccctccagtc
catagtttagtaagcattggaggaaggaagttttcccttgatagatcacagttaggtttg
aaaagcattattgatgttccccatcaaaatggtactgccattgacattctcggaaggatg
acttcaatacttgagcaaatacacactccaattgcttcaaattctgcttttggaacaaat
ttgcttcaagaaggagaagaaaacatcggtcaattcctttatcttgaaggaattgaatat
cacatgtggaacacgtatgatgttcatttctatgcttcttttgcactaatcatgttgttt
ccaaaacttcaactcagtatccagagagactttgcagctgcagtaatgatgcacgatcct
agtaaaatgaaacttttacatgatggacaatgggttccaagaaaggttcttggagctgtt
ccacatgatattggaatcgatgacccatggtttgaagtaaatgcatactgcctttatgac
actgatagatggaaagacttgaatccaaaatttgttctccaagtttatagggatgtggtt
gccactggtgacaagaggtttgcagaagctgtttggccctcagtttatgttgcaatggct
tatatggatcaatttgacaaggatggagatgggatgattgagaatgaaggcttccctgat
cagacatatgatacatggtctgtgtctggtgtaagtgcctatagtggcgggctatgggtc
gcagccttacaggctgcatctgcccttgcacgtgaagtaggagacaagggttctgaagat
tatttttggttcaagtttctgaaggccaaagctgtctatcaaaaattgtggaacggctct
tacttcaattacgacgacagtggcagtcgcacaagctcatctattcaggctgatcaattg
gctggacaatggtatgcaagggcatgtggtcttttgccaatagttgatgaagacaaagcg
agaagcacattagagaagatatacaattacaatgtcttaaaagtgaaagatggaaagcgg
ggggctgtgaatgggatgctgcctgatggaagagttgatatgtcatcaatgcaatcaaga
gaaatatggtctggagtaacatatgcggtggctgcaacaatgatccatgaagatttggtg
gatatggcatttcatactgcaggtggaatctttgaagcggtttggtctgaaaaaggactt
ggttactcatttcaaactccggaagcttggaatgtagatgatcagtacagatctctagct
tacatgcgccctttggccatatgggctatgcaatgggccttatcaagacaaaagcttcct
aagcaggagccaaaacctgaattgaaagcagattccttacgtatacaccatgccggattc
tccaaagttgctcggcttctaaagttgcccgaagagcaaggaaccaggagccttttacag
gttatgttcgactatacttgcaagagaatgttgatttaa

DBGET integrated database retrieval system