KEGG   Theobroma cacao (cacao): 18607476Help
Entry
18607476          CDS       T02994                                 

Definition
(RefSeq) heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00900  Terpenoid backbone biosynthesis
tcc01100  Metabolic pathways
tcc01110  Biosynthesis of secondary metabolites
Module
tcc_M00366  C10-C20 isoprenoid biosynthesis, plants
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    18607476
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:tcc01006]
    18607476
Enzymes [BR:tcc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     18607476
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     18607476
    2.5.1.29  geranylgeranyl diphosphate synthase
     18607476
Prenyltransferases [BR:tcc01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   18607476
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 18607476
NCBI-ProteinID: XP_007041720
Position
2
AA seq 341 aa AA seqDB search
MLAFSTVITSGPNLYLPKKPRNFHFPIRCLSSTSLSASSQPSKLTQFDLKTYWTTLIAEI
NQKLEEAIPVKYPEQIYEAMRYSVLAKGAKRAPPVMCVAAYELFGGNRLAAFPTACALEM
VHTASLIHDDLPCMDDDPVRRGQPSNHTIYGVDMAILAGDALFPLGFRHIVSQTPTELVP
EARILRVIAEIARTVGSAGMAAGQFLDLKGDANSVDFIQEKKYGEMSECSAVCGGLLAGA
EDDEIERLRRYGRAVGVLYEVVNDVLEAKLVEKEETEKNQKKGKSYVSMYGVKKAMEVAE
DLQTKSKGELDGFDKYGESVAALYSFIDYAFYRDFNVDDLS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgttggctttttcaacagtgataacatcagggccaaatctataccttccaaagaaaccc
cggaattttcacttcccaattcggtgcctttcttcgacatctttatcagcttcgagccaa
ccatcaaagttgacccaattcgatttaaagacttactggactacccttatagcagaaatc
aatcagaagcttgaagaagcaatcccggtcaagtacccagagcagatctatgaagctatg
aggtactctgttcttgcaaagggtgctaagcgagcccctcccgttatgtgtgtcgccgct
tatgaactctttggtggtaaccgactcgctgcttttcctacagcttgtgctcttgaaatg
gttcacactgcttcactaattcatgatgatcttccctgcatggatgatgatccagtacgc
agaggtcaaccgtctaaccatacaatttatggtgtcgacatggcaatcctggctggtgat
gcactcttccctcttggcttccgccatattgtctctcaaacacctactgaacttgttcct
gaggcacgcatcttgcgtgtgattgctgagattgcccgcacagtgggatctgctggcatg
gctgctgggcagttcctagacctcaagggtgacgccaattctgttgattttattcaagag
aaaaaatatggtgaaatgagtgagtgctctgcagtgtgtgggggtttgttggctggtgct
gaagatgatgagatagaaaggttgagaaggtatgggagagctgttggtgtattgtatgaa
gtggttaatgatgttttggaggcaaaattggtggaaaaggaggaaactgagaagaaccaa
aagaaaggtaaaagttatgtgagtatgtacggggttaagaaggcgatggaggtggcagaa
gaccttcagaccaagtctaagggcgaattggatgggtttgacaagtatggtgagagtgta
gcagcactatatagcttcatagattatgctttttatagagacttcaatgttgatgacttg
agctaa

DBGET integrated database retrieval system