KEGG   Theobroma cacao (cacao): 18608485Help
Entry
18608485          CDS       T02994                                 

Definition
(RefSeq) probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00020  Citrate cycle (TCA cycle)
tcc00640  Propanoate metabolism
tcc01100  Metabolic pathways
tcc01110  Biosynthesis of secondary metabolites
tcc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    18608485
   00640 Propanoate metabolism
    18608485
Enzymes [BR:tcc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     18608485
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     18608485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 18608485
NCBI-ProteinID: XP_017971287
Position
2
AA seq 351 aa AA seqDB search
MARQASRLIKSLSSKISPRNPQISPLSPFSSTSSSSSSSSLTLSRSFSAAPAPQPAVFVD
KNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKA
NASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLIGPNCP
GIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNG
TNFVDCVTKFLDDPQTEGIVIIGEIGGTAEEDAAALIKESGTKKPIVAFIAGLTAPPGRR
MGHAGAIVSGGKGTAQDKIKTLREAGVTVVESPAKIGVAMLNVFKERGLVN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggctagacaagcctcacgactcatcaaatccttgtcttccaagatttctcctcgcaac
cctcaaatatccccactcagtcccttctcctccacttcctcttcctcttcctcttcttct
ttgactctatcacggtctttttcggcggctccagcgcctcaacctgcggtgttcgtggac
aagaatactcgcgtcatttgccaaggcatcactggaaagaatggaactttccacaccgag
caagccattgaatacggcactaagatggttggtggagttacaccaaagaagggtggcaca
gagcatttaggacttcctgttttcaacacagttgccgaagcaaaggctgaaaccaaggcc
aatgcttctgtcatttatgtgcctcccccttttgctgcggctgctatcatggaggctatg
gaagctgaattggatcttgttgtgtgcatcacggaaggaattcctcaacatgacatggtc
cgtgtgaaggcggcccttaatcagcaatcaaaaaccaggctgattggtccaaactgccct
ggtatcattaaacctggggaatgcaagattggaattatgcctggatatattcacaaacca
ggtcgcgtaggaattgtttctcgatcgggcactttaacatatgaagcagttttccaaaca
actgcagttggtctggggcaatcaacctgtgtaggaattggtggggatccttttaatgga
accaacttcgttgattgtgtgacaaaattccttgacgatcctcaaacagaaggtatcgtt
ataattggtgagatagggggcactgcagaagaagatgctgctgcactaataaaggaaagt
ggcactaaaaagcctattgtagccttcattgctggacttactgctcctccaggacggcgt
atgggtcacgctggagctatagtatctgggggaaagggcacggcgcaggacaaaatcaag
acactaagggaggctggagtgacggttgttgaatcacctgcaaagattggtgtagcaatg
cttaatgtcttcaaggaaagaggtctcgtgaattag

DBGET integrated database retrieval system