KEGG   Theobroma cacao (cacao): 18608795Help
Entry
18608795          CDS       T02994                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 3, peroxisomal
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00071  Fatty acid degradation
tcc00592  alpha-Linolenic acid metabolism
tcc01040  Biosynthesis of unsaturated fatty acids
tcc01100  Metabolic pathways
tcc01110  Biosynthesis of secondary metabolites
tcc01212  Fatty acid metabolism
tcc04146  Peroxisome
Module
tcc_M00087  beta-Oxidation
tcc_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    18608795
   00592 alpha-Linolenic acid metabolism
    18608795
   01040 Biosynthesis of unsaturated fatty acids
    18608795
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    18608795
Enzymes [BR:tcc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     18608795
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_ox_N
Motif
Other DBs
NCBI-GeneID: 18608795
NCBI-ProteinID: XP_007043726
Position
2
AA seq 676 aa AA seqDB search
MDRAFQRTKILTNHLLQSSPSSPAQIPSLSSNACLDYSPPELSEGYAFDIKEMRQLLDGH
HVADRDWLFGMMMQSKLFNPRVRGGKVFVSPDYNQSMEQQREMTWKRIVYLLERGVFKGW
LTEKGEEAEMRKFAYFEALGLFDHSIAIKLGVHFFLWGGAIQFFGTKHHHDKWLRDTENY
LIKGCFAMTELGHGSNVRGIETVTTYDSNTGEFVINTPCESAQKYWIGGAANHATHTIVF
SQLNINGTNQGVHAFIAQIRDAVGNVCPNIRIADCGHKIGLNGVDNGRIWFDNVRVPREN
LLNSVADVSADGKYLSSIKDPDQRFAAFLAPLTAGRVNIAVSAVYQSKVGLAIAIRYALT
RRAFSVKPNEPEVLLLDYPSHQRRLVPLLAKTYAMSFAANYLKMLYVKRTPQSNKTIHVV
SSSFKAVFTWNNMQILQECREACGGQGLKTENRVGHLKGEHDVQSTFEGDNNILMQQVSK
ALFAEYVAAQKKNKAFKGLGLEHMNKPCPVIPSQLTSATLRCSQFQMDALCLRERDLLKC
FVLDVSQHQAKGESKEHAFIMSYQLAEDLSRAFSDRAIFQKFVEAEATLAAGSLKDVLGM
LRSLYALICIEDVAFLRYGYLSVDNAAAVRREITKVCSELRPHALALVSSFGIPDAFLSP
VAFNWIDANSWSSVQH
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggatagagctttccaaagaaccaaaatcctaaccaatcacctcctccaatcctctcct
tcttcgcccgcccaaatcccttctctttcttcaaacgcatgcttagactactctccgccc
gaactttccgaaggttacgcatttgacatcaaggagatgcggcagctcctcgacgggcac
cacgtggctgaccgcgattggctattcgggatgatgatgcagagcaaattgttcaacccg
agagtgaggggagggaaggtgttcgtgtcgccggactataaccagtcgatggagcagcag
cgggagatgacgtggaagcgcatcgtgtatttgttggagagaggagtttttaaagggtgg
ttaacggagaaaggagaagaggctgagatgaggaagtttgcttactttgaagccttgggt
ctcttcgatcattccattgcgattaagctcggagttcacttcttcttgtggggtggtgcc
atccaatttttcggtacaaagcaccaccatgacaagtggctgagggacactgaaaattat
ttgatcaagggttgctttgcaatgactgagttggggcatggaagtaatgttcgtggcatt
gaaacagtaaccacatatgattcaaacacaggggagtttgtcattaatactccttgtgaa
tcagctcagaagtattggattggtggggcagccaaccatgcaacacatacaattgtgttt
tcacagctaaatatcaatggaaccaatcaaggtgttcatgcatttatagcccaaatcagg
gatgctgttggtaatgtatgcccaaacattcgcattgctgattgtggtcataaaattggt
ttaaatggtgttgataacggtcgaatctggtttgacaatgttagagtgcccagagagaac
ttgttaaattcagttgctgatgtgtcagctgatggaaaatatctaagttcaataaaagat
ccagatcagaggtttgctgcattcctggccccgttgacagcaggtcgtgttaatattgca
gttagtgcagtttaccaatcaaaggttggcttagcaattgccattaggtatgcattaaca
aggcgggctttttctgtcaaaccaaatgaacctgaggtcttattgcttgattacccaagt
catcaacgacgacttgtgcctctccttgcaaagacctatgctatgagttttgcagcaaat
tacttgaaaatgttgtatgtgaagaggacacctcagtcaaacaaaaccattcatgtagtt
tcaagttcattcaaggctgtttttacatggaataacatgcaaatacttcaggaatgtcgt
gaagcttgtggaggacaaggattaaagactgagaatcgtgttggtcatcttaaaggtgaa
catgatgtgcaatccacttttgagggggacaataatattttgatgcagcaggtcagcaag
gctctttttgctgaatatgttgcagctcagaagaaaaacaaggctttcaagggtctgggc
ttagaacacatgaataaaccctgtcctgtcattccatcacagcttactagtgctaccctc
agatgcagccaattccagatggatgccttgtgcttaagggagagagatcttttgaaatgt
tttgtcctggatgtctcacaacatcaagccaagggagaaagtaaagagcatgctttcatt
atgagttatcagctagcagaggatttgagcagagctttctcagatcgagcaatattccaa
aagtttgttgaggcagaagcaactctagctgccggttcgttgaaggatgtcctaggtatg
ttgagatcattgtatgccttaatttgtattgaagatgttgcatttctccgatatgggtac
ctgtcagtggacaatgctgctgctgtgaggagagaaataacaaaagtctgcagtgaactt
cgaccacatgcgcttgctttagtcagttcctttggcattcctgatgcttttctgagccct
gtagctttcaactggattgatgcaaattcttggtcttcggttcagcactga

DBGET integrated database retrieval system