KEGG   Theobroma cacao (cacao): 18608830Help
Entry
18608830          CDS       T02994                                 

Definition
(RefSeq) glycine--tRNA ligase, mitochondrial 1
  KO
K01880  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    18608830
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tcc01007]
    18608830
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tcc03016]
    18608830
   03029 Mitochondrial biogenesis [BR:tcc03029]
    18608830
Enzymes [BR:tcc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     18608830
Amino acid related enzymes [BR:tcc01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   18608830
Transfer RNA biogenesis [BR:tcc03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    18608830
Mitochondrial biogenesis [BR:tcc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    18608830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HGTP_anticodon tRNA-synt_2b WHEP-TRS
Motif
Other DBs
NCBI-GeneID: 18608830
NCBI-ProteinID: XP_007043777
Position
2
AA seq 739 aa AA seqDB search
MRFLFALISSSVSFGLNSSSRLTLRHLHALSSKSQRSTLTTFFNWQPPMATAEESLRRAL
AEKQSAVEAQGNAVRALKAAKASKPEIDAAIEALNSLKLEKSSIEKQLQAAVSGNDGDAS
LSREAFRQAAVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEEN
MLEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCNEKLQKDLSISA
EKAAELKHVLATLDDLSAEELGAKIKEYGITAPDTKNPLSDPFPFNLMFQTSIGPSGLSP
GYMRPETAQGIFVNFKDLYYYNGNKLPFAAAQIGQAFRNEISPRQGLLRVREFTLAEIEH
FVDPEDKSHPKYSEVVNLEFLMFTREEQMSGQSAKRTRLGDAVSKGIVNNETLGYFIGRV
YLFLTCLGIDKDRLRFRQHLANEMAHYAADCWDAEIECSYGWIECVGIADRSAYDLRAHS
EKSGVPLVAAEKFLEPREVEKLVIAPVKKELGLAFKGNQKKVVEALEAMNEKEALEMKAA
LESKGEVEFYVCTLGKNVPIKKNMVSISKEIKKEHQRVFTPSVIEPSFGIGRIIYCLFEH
SFYTRPSKAGDEQLNVFRFPPLVAPIKCTVFPLVQNQQYEDVAKVISKSLTAAGISHKID
ITGTSIGKRYARTDELGVPFAITVDSTKDVTIRERDSKLQVRVDVEEAASVVKSVTDGQR
TWEDVWANYAHHTSGSADD
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgcgctttctcttcgctctcatttcctcatctgtttcctttggtctcaattcctcctcc
cgattaacattacgccacttacacgccctctccagcaaatcccagcgatcaaccctaacc
accttttttaattggcaaccaccaatggccacagccgaggaatcgctccgcagagcacta
gccgagaagcaatcggctgttgaagcgcagggcaacgcggtgagagctctgaaagccgcc
aaggcctctaagcctgaaatcgacgctgcaatcgaagccttgaacagcttgaagttggag
aaatcgtcgatagagaagcagctgcaggctgctgttagtggtaacgatggggatgcctcc
cttagcagggaagctttccgtcaagccgctgtgaatactttagaacggcgtttgttttac
atcccgtctttcaagatttatcggggtgttgctgggctttatgactatggaccgcccggt
tgcgccgttaaatctaacgttcttgctttctggcgtcagcactttgtccttgaggagaac
atgttggaggttgactgcccctgtgtgacaccagaggttgtcctaaaggcatctggtcat
gtggataaatttactgaccttatggttaaggatgaaaaaactgggacctgctatcgggct
gatcacttgcttaaggatttctgcaacgagaagcttcagaaagacctcagcattagtgca
gagaaggctgctgagcttaaacatgtccttgctactttggatgacctgtcagctgaagag
ctaggtgcaaagatcaaggagtatggtattactgctccagacacaaaaaatccgctctcg
gatccttttccattcaacttaatgttccaaacatcaattggtccatctggtttgagccct
gggtatatgcgtcctgaaacagcacaaggaatatttgtgaattttaaagacttgtactat
tacaatgggaacaagcttccctttgctgcagcccaaatcggtcaggctttccgaaatgag
atatccccacgccaagggcttctgagggttcgagaatttactctagcagagattgagcac
tttgtcgatcctgaagacaaatctcatccaaaatactctgaagttgtgaacttggagttt
ctgatgttcacaagggaagagcaaatgtctgggcaatctgcaaagagaacacgtcttggt
gatgcagtttcaaagggaattgtcaacaatgaaacccttggctactttattggtagagtt
tatctcttcctaacttgccttggtatagacaaagaccgtttacggttccggcagcatctt
gcaaatgaaatggcacattatgctgcagactgttgggatgctgagattgagtgttcatat
ggttggattgaatgtgttggtattgcagataggtctgcttatgacttgcgtgctcattca
gagaaaagtggtgtcccactggtggctgctgagaaatttttagaacctagagaagtggag
aaactggttatagctcctgtgaagaaagaactcggccttgcattcaaggggaaccaaaag
aaggtggttgaagctttagaggcaatgaatgaaaaagaggctttggaaatgaaggctgct
ttggaatccaaaggggaggtggaattctatgtctgcactcttgggaaaaatgtgcccatt
aaaaagaacatggtctctatttcaaaggagataaagaaagaacaccagagagtttttacg
ccatctgtgattgaaccatcctttggaattggacggataatttattgcctttttgagcac
tctttctacacgaggccaagtaaagctggggatgagcagttgaatgtgtttcggtttcct
cctcttgtggcacctatcaaatgtactgtatttccacttgttcaaaatcaacaatatgag
gatgttgccaaagtcatttcaaagtcattgacagctgctggaatctcgcataagatagat
atcacaggtacctcaataggaaaacggtatgcaagaacagatgaacttggtgtaccattt
gccataactgttgattcaacaaaagatgtgacaatccgggagagagacagcaagcttcaa
gtccgtgttgatgtagaagaggcagcatctgttgttaagtctgtaactgatggacagaga
acatgggaggatgtgtgggcaaattacgcccatcacacatctggctcagcagatgattga

DBGET integrated database retrieval system