KEGG   Theobroma cacao (cacao): 18611851Help
Entry
18611851          CDS       T02994                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc03013  RNA transport
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    18611851
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:tcc03012]
    18611851
Translation factors [BR:tcc03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    18611851
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 18611851
NCBI-ProteinID: XP_007048374
Position
1
AA seq 992 aa AA seqDB search
MANFARAENALKRADELINVGQKQDALQALHDLITSKRYRAWQKTLERIMFKYVELCVDM
RKGRFAKDGLIQYRIVCQQVNVSSLEEVIKHFMHLSSEKAEQARTQAEALEEALDVDDLE
ADNRPEDLMLSYVSGEKGKDRSDRELVTPWFKFLWETYRTVLEILRNNSKLEALYAMTAH
RAFQFCKQYKRTTEFRRLCEIIRNHLANLNKYRDQRDRPDLSAPESLHLYLDTRFEQLKI
ATELKLWQEAFRSVEDIHGLMCMVKKTPKSSLMVVYYAKLTEIFWISASHLYHAFAWFKL
FTLQKNFNKNLSQKDLQLIASSVVLAALSVAPYNQTRGASHLKHENEKEHRIRMANLIGF
NLDPKVDNREVVSRSLLLSELVSKGVLSCATQEVKDLYHLLEHEFLPLDAASKIQPLLTK
ISKLGGKLSSASSVPEVQLSQYIPALEKLATLRLLQQVSQVFQTMKMESLSQIIPFFDFS
MVEKISVDAVKHNFIAMKFDHMKGIVVFGNMGLESDGLRVHLTNFAESLNKARAMIHPPV
EKASKLAEILPGLGEVVDKEHKRLLARKSIIEKRKEEQERQLLEMEREEESRRLKMQKIT
EEAEQKRLAAEFEQRRAERIRQEIEERELEEAQALLEETEKRIRKGGKKKSILEGEKLTK
QVLMERAMTEQLKERQEMEKKLHKLAKTMDYLERAKREEAAPLIEAAFQQQLVEERVLHE
REQQLEVELSRQHHDGDLREKNRLARMMDNKIIFQERVMSCRQVEFDRRREEREERISQI
IQARKKEREFKRKKIFYVRSEEERLRKLHEEEEARKLEEAERRRKEEAERKAKLDEIAEK
QRQRERELEEKERLRREALLGRSTEGLSRPSELPAGSHPSEPGAAAAPTTGKYVPRFKRE
RAVGSGQAPPSESDHWGSGSQAPPSQSDRWGSGSRAPPQDPERVGSGASRPLPHDSDRMG
GSRAPQEPDKWGGNSSKTEPWRPSRARNPPRG
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atggcaaattttgccagagctgagaatgcattaaaacgagctgacgagttgataaatgtt
gggcagaagcaagatgcgttgcaagctcttcatgatttaattacctcgaaacggtatcga
gcttggcaaaaaacactcgaaagaattatgtttaaatatgtagaactttgtgttgatatg
cgaaaaggtcgctttgcaaaggatggtttgattcaataccgaattgtatgtcagcaagtt
aacgttagttcattagaggaagttatcaaacacttcatgcatctttcctctgagaaggct
gagcaggctcgtactcaggcagaagccttggaagaagctcttgatgtagatgacctcgag
gcagataacagacctgaggatttgatgttaagttatgttagtggagagaaaggaaaggat
aggtcggatcgagaacttgttacaccttggttcaagtttttgtgggagacgtatagaact
gtgcttgaaattttgcggaataactcaaagttggaggctctatatgcgatgacagcacac
cgagcattccagttttgcaaacagtataaacgaacaacggagttccggaggttgtgtgag
attataagaaatcatttagcaaatcttaacaagtatagagatcagagggacaggcctgac
ctatctgcgccagagagcttgcatttgtatcttgatacaagatttgagcaacttaagata
gctactgaactcaaactctggcaggaagcttttcgatctgttgaagacattcatggattg
atgtgcatggttaagaaaacccccaaatcttcattgatggttgtttattatgccaagctg
actgaaatcttttggatttcagctagccatctctatcatgcttttgcatggtttaagctt
tttacacttcaaaaaaacttcaataaaaacttaagccagaaggatttgcaattgatagca
tcgtcagttgttttggctgctctatcagtggctccttacaatcaaacacgtggagcatca
cacctgaagcatgaaaatgagaaagagcatagaataaggatggcgaatcttataggattt
aatcttgatcctaaagttgataacagagaagtggtttcaaggtcattgcttctctcggaa
ctggtctcaaaaggtgtacttagttgtgcaactcaggaagtgaaagatctttatcatctt
ttagagcatgaatttctgcctctggatgctgcatcgaagatacaacctttgttgacaaaa
atctcaaaacttggtggaaagctgtcttctgcttcatctgtaccagaagttcaactctcc
caatacattcctgcccttgaaaaacttgctactttgaggttgcttcagcaggtgtctcag
gtttttcagacaatgaaaatggagagcttgtctcagatcattcccttttttgatttttca
atggtggaaaagatttctgttgatgctgttaaacataattttattgctatgaaatttgat
catatgaagggcattgtggtgtttggtaatatgggtcttgaatctgatgggctgagggtt
cacttgactaattttgctgaatctttgaataaagcaagagccatgatacacccccctgtg
gagaaagcatcaaaactagctgaaatcttgccaggcttgggcgaggttgtagataaggaa
cacaaaaggcttcttgctcgaaaatcaatcattgagaaaagaaaggaagaacaagaacgg
caactgttggaaatggaacgagaggaggagtcaaggaggttgaaaatgcagaagataact
gaggaagcagaacagaagaggcttgctgctgagtttgagcaacggagagcggaaaggatt
cgtcaggaaatagaggagcgggagcttgaagaagcacaggcactactggaggaaactgag
aagcgtataagaaagggtgggaagaagaaatcgattttagaaggggagaaattgacaaag
caagtcttgatggagcgggccatgactgagcagctcaaggagagacaggagatggagaag
aaactgcacaaacttgctaaaacaatggactatttggaaagggcaaagagagaggaggca
gctcccttgattgaagctgcttttcaacaacaactagtggaagagagagtgcttcatgaa
cgtgagcaacagttggaagttgagctgagcagacagcatcatgatggggatctgagagag
aagaacaggctagcacgtatgatggacaataagataatattccaggaaagagtgatgagt
tgtcggcaggtcgagtttgaccgacggagagaagagagggaggagagaatcagtcaaata
attcaggcacggaagaaggaaagggagtttaagagaaagaaaatattctatgtgaggtct
gaagaggagagactgagaaagctacacgaagaggaagaagctcgtaaacttgaagaggca
gaaagacgaaggaaagaagaagctgaacgcaaggcaaaattggatgagattgctgaaaag
cagaggcagagagaacgagaattggaagaaaaggaaaggctgagaagggaagctctttta
ggaagatcaactgaggggctctccaggccttctgagcttcctgctgggtcccacccatct
gaacctggagctgctgctgcacccaccactgggaaatatgtgcctaggttcaagcgagag
agagccgtaggctctggacaagccccaccttcagaatctgatcactggggtagtggcagt
caggccccaccttcacaatctgatcgctggggtagtggcagcagggcaccacctcaggat
cctgaacgtgtaggcagtggtgctagcaggcccctccctcatgattccgatcgtatgggt
ggtagcagggctcctcaggagcctgataaatggggtggtaatagcagcaagacggaaccc
tggcgaccatcaagggccaggaacccaccacgtggttga

DBGET integrated database retrieval system