KEGG   Theobroma cacao (cacao): 18613565Help
Entry
18613565          CDS       T02994                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 2
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00520  Amino sugar and nucleotide sugar metabolism
tcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    18613565
Enzymes [BR:tcc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     18613565
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 18613565
NCBI-ProteinID: XP_007050928
UniProt: A0A061DQT8
Position
1
AA seq 440 aa AA seqDB search
MGSELIYRGHETHPASDSYSPKPVKPWASVIRPIRYMLREQRLLFVLVGIAIATLIFTIF
PTSRAPHVPHHHFTTSISDSITYFPIEPQNKFSYPHRVGFESANPTGKIPLGLKRKGLRI
VVTGGAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPLLL
EVDQIYHLACPASPVHYKFNPVKTIKTNVVGTLNMLGLAKRVGARFLLTSTSEVYGDPLQ
HPQKETYWGNVNPIGVRSCYDEGKRTAETLTMDYHRGAGVEVRIARIFNTYGPRMCIDDG
RVVSNFVAQALRKEPLTVYGDGKQTRSFQYVSDLVEGLMRLMEGEHVGPFNLGNPGEFTM
LELAEVVQETIDPNAKIEFRPNTEDDPHKRKPDISRAKELLGWQPKVSLRKGLPLMVSDF
RQRIFGDHKEGSNTNNASTS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggggtcggagctgatatacagaggccacgagacccatcctgcttcggattcatattcg
cccaaacccgttaaaccatgggcctccgtcatccgcccgattcgttacatgctcagagaa
caacgacttctcttcgtgcttgtcggcattgcgatagccactctgattttcaccatcttc
ccaacctcacgtgccccgcacgttccccaccaccactttaccacctcgatctccgattcc
atcacctacttccccatcgagccccagaacaagttctcctacccgcaccgggtcgggttc
gagtcagccaacccgaccggtaagattccgctggggctaaaacggaagggtttgagaatc
gtagtaacgggtggagccgggttcgtcgggtcccacctcgtggaccgtctgatagctaga
ggagacagcgtaatcgtcgtcgataacttcttcacgggaaggaaagagaacgtcatgcac
cacttcggaaacccaaacttcgagcttatccgacacgacgtcgtggaacctttgctcttg
gaagttgaccagatctaccatctcgcttgccccgcttctccagttcattacaaattcaac
ccagtcaaaactatcaagacgaatgtggtggggacattgaacatgttaggcctggctaaa
agagtaggtgccaggttcttattgaccagtaccagcgaagtgtacggagatcctctgcaa
catcctcagaaggaaacttactggggcaacgttaatcccatcggtgtccgcagttgctac
gatgagggaaagcgtactgctgaaacgttgaccatggactatcacagaggcgccggcgtt
gaggttaggattgccagaattttcaatacttacggacctcgtatgtgcatcgatgatggt
cgtgtcgttagcaatttcgttgctcaggctttaaggaaggagcctttgactgtatatggc
gatgggaaacagactaggagtttccaatatgtttctgatctggtggagggtctcatgcgc
ttgatggaaggtgaacacgttggaccttttaatcttggaaatccgggtgaattcaccatg
cttgagcttgctgaggtcgtccaggaaacaattgacccgaatgcaaagatagagtttaga
cccaacacagaagatgacccacacaagaggaagcctgatatctcaagagccaaggagcta
cttggttggcaacccaaggtgtcccttcgaaagggtctccctctaatggtttcagacttc
cggcaacgtatttttggtgaccacaaggagggcagcaacaccaacaatgcatcaacatct
taa

DBGET integrated database retrieval system