KEGG   Thermococcus celer: A3L02_00260Help
Entry
A3L02_00260       CDS       T05076                                 

Definition
(GenBank) digeranylgeranylglycerophospholipid reductase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
tce  Thermococcus celer
Pathway
tce00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A3L02_00260
Enzymes [BR:tce01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     A3L02_00260
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     A3L02_00260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 Lycopene_cycl FAD_oxidored DAO FAD_binding_2 Trp_halogenase Pyr_redox_2 NAD_binding_8 Thi4 HI0933_like GIDA 3HCDH_N AlaDh_PNT_C DUF596 GDI SE BCAS2
Motif
Other DBs
NCBI-ProteinID: ASI99879
UniProt: A0A218P4L9
Position
49215..50396
Genome map
AA seq 393 aa AA seqDB search
MKYDVVVVGAGIAGPIVARNVARAGFSVLLIDKKPAIGAPKQCAEGISIKVFDKYDIPYD
RRYINREIYGAKLYSPSGHELELRYKEVSGVILERKVFDKMLAYYAAKAGADVLARTEAT
DVIRRDGRIAGIRAKHEDEPVEIRADIIVAADGVESTIARKAGINTYAPPHEFDSSYEYE
MLIEGYDPDLIHLWFGNEIAPRGYVWVFPKDEDRANVGIGINSDNPETAKYYLDKWLRDN
NIPARKLLEVNVGVVPVGGFVRELAKDNVVVVGDAARQVNPMHGGGMAEAMEAGTIASKW
IVRALEEENLSLLQNYTKEWWETDGKRLEKVLKVRKVTEKLTDEDLDLFIQVLSGADAEK
IAGGDYVEVIKALLKHPKVILSPRRIKLLKQLI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacgacgtcgttgtcgtcggcgccggaatcgccggccccatagttgcgaggaac
gttgccagagccggtttctcggttctgctcatcgataaaaagcccgccataggcgcaccg
aagcagtgcgccgaggggataagcatcaaggtcttcgacaagtacgacatcccctacgac
agacgctacatcaaccgcgagatctacggggcgaagctctactcgccgagcggccacgag
ctcgagctccgctataaagaggtcagcggggtcatcctcgagaggaaggtcttcgacaag
atgctcgcctactacgccgcgaaggccggtgccgacgtcctcgccagaaccgaggcgacg
gacgtcataaggagggacggaaggatagccgggatcagggccaagcacgaggacgagccc
gtcgagatacgcgcggatatcatagtcgcggccgacggtgtggagagcaccatcgcgagg
aaggccggcataaacacctacgccccgccgcacgagttcgactcctcctacgagtacgag
atgctcatcgagggctacgacccggatctaatccacctctggttcggcaacgagatagcg
ccgaggggctacgtctgggtcttcccgaaggacgaggacagggccaacgtcgggataggc
ataaactccgacaaccctgaaactgctaagtactacctcgacaagtggttgagggacaac
aacatccccgccaggaagctcctcgaggtaaacgtcggcgtcgttccggtcggcggtttc
gtcagggagctggcgaaggacaacgttgtagtggtcggcgacgccgcgagacaggtcaac
ccgatgcacggtggtggtatggccgaggccatggaagcgggaaccatagcgagcaagtgg
atagttagggccctcgaggaggagaacctctccctgctccagaactacacgaaggagtgg
tgggagacggacggaaagcggctcgagaaggttctcaaggtcaggaaggtaactgaaaag
ctcacggacgaggacctcgacctcttcatccaggttctcagtggcgccgacgccgagaag
atagcgggcggcgactacgtggaggtcatcaaggccctcctgaagcacccgaaggtcata
ctgagccccaggaggataaagctcctgaaacagctgatttga

DBGET integrated database retrieval system