KEGG   Thermococcus celer: A3L02_08775Help
Entry
A3L02_08775       CDS       T05076                                 

Definition
(GenBank) nicotinamide-nucleotide adenylyltransferase
  KO
K00952  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
tce  Thermococcus celer
Pathway
tce00760  Nicotinate and nicotinamide metabolism
tce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    A3L02_08775
Enzymes [BR:tce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     A3L02_08775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: ASI99645
UniProt: A0A218P426
Position
complement(1630076..1630636)
Genome map
AA seq 186 aa AA seqDB search
MKRGLFVGRFQPVHNGHIKALEFVFSQVDEVIIGIGSAQASHTLKNPFTTSERMEMLIRA
LNEAGMDKRYYLIPLPDINFNAIWATYVVSMVPRFDVVFTGNSLVAQLFREKGYEVVVQP
MFRKDILSATEIRRRMVEGQPWEELVPESVARFIREIKGVERIRMLATNLEKNEKELQAP
IRIPEF
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcggtctcttcgtcggacgttttcagcccgtccacaacgggcacataaaggcc
ctcgagttcgttttttcgcaggttgatgaggttatcattggaatcgggagtgcacaggcg
agccacacactgaagaaccccttcacgacgagcgagaggatggagatgctaatcagggcg
ttgaacgaggccggcatggacaagcgctattacctgatccccctcccggacatcaacttc
aacgccatctgggccacatacgtggttagcatggtaccgcgcttcgacgtcgtcttcacc
gggaactccctcgtcgcccagctcttccgcgagaagggctacgaggtggtggttcaaccg
atgttcaggaaggacatcctctcggcgacggagataaggagacgcatggtcgagggccag
ccgtgggaggagctggtcccggagagtgtggcgaggttcatccgtgaaataaagggcgtc
gagaggataaggatgctcgcgaccaaccttgagaagaacgagaaggagctgcaggcgccg
ataaggattccggaattctga

DBGET integrated database retrieval system