KEGG   Thermococcus chitonophagus: CHITON_0999Help
Entry
CHITON_0999       CDS       T04536                                 

Definition
(GenBank) Mannose-1-phosphate guanylyltransferase
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
tch  Thermococcus chitonophagus
Pathway
tch00051  Fructose and mannose metabolism
tch00520  Amino sugar and nucleotide sugar metabolism
tch01100  Metabolic pathways
tch01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CHITON_0999
   00520 Amino sugar and nucleotide sugar metabolism
    CHITON_0999
Enzymes [BR:tch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     CHITON_0999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 IspD ATP-synt_F6 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: CUX77778
UniProt: A0A161KAF8
Position
I:952274..953515
Genome map
AA seq 413 aa AA seqDB search
MKAVILAGGFGTRLRPISSTRPKPMVPVLGKPNLQYILEALEKVGEIDEVILSVHYMRGE
IREFIQEKMQDYPKDIKFVNDPMPLETGGALKNVEDYVSDDFLVIYGDVFTNFNYSELIE
AHKKNDGLITVALTKVYDPERFGVVITDEEGKIVEFEEKPRKPKTNLVDAGIYVVNKDVL
KEIPKNKEVYFEREILPKFVSEGLVYGYKMPKEYYWVDLGTPDDLFYAHQIALDELAREN
GYMILGENVDIPEDVEVQGPVYIDSNAKIGHGVKIKAYTYIGPNTIIEDKAYIKRSILLG
SDIIKERAELKDTILGEGVVVGKNVIVKENAVVGDYAKIYDNLVIYGAKILPWKKVEEYE
AYIRIKLDPAKVRPELTPDRCPLGLPECIYKKFKAIAGEKPPCDECIENQWLF
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtgattcttgcgggtggttttggaactagattgaggcccatttcatcaacg
aggccaaagccaatggttcccgtccttgggaagcctaaccttcagtacattctcgaggcc
cttgagaaggttggtgagattgacgaagttatactctcagttcactacatgaggggcgag
attagggagttcattcaagagaagatgcaggattatccaaaggacattaagttcgtcaac
gatccaatgcctctagaaacaggtggagccctaaagaatgtggaagattatgtgagcgat
gatttcctggtaatttacggtgacgtgttcacgaacttcaactattctgagctcatagag
gcacacaagaagaacgatgggttaataaccgttgcactaaccaaggtctacgatcctgag
aggttcggcgttgttataactgacgaagagggtaagatagtagagttcgaggagaagccc
aggaagcccaagactaacttagtcgatgctggaatatatgtggtcaacaaggacgttcta
aaggagataccaaagaacaaggaagtttactttgagagagagatccttccgaagttcgtc
agcgagggcttggtctacgggtacaagatgccaaaggagtactactgggttgaccttgga
actcccgatgacctcttctatgcccaccagatagccttggatgagcttgcaagggagaac
gggtacatgatacttggcgagaacgtcgatattccagaagacgttgaggttcaagggccg
gtgtacattgacagcaacgcgaagatagggcatggggttaagataaaggcctacacgtac
ataggcccgaacacgataatcgaggacaaggcatacatcaagagatcgatactgctaggt
agcgatataataaaggagagggccgagctgaaggacacgatccttggagagggagtcgtc
gtagggaagaacgttatcgtcaaggaaaacgcagttgttggagactacgcaaagatctat
gataaccttgttatctacggagctaagatactcccatggaagaaagttgaagagtatgag
gcgtacataaggatcaagcttgacccagcaaaggtgaggccagagctaacgcctgacagg
tgtcccctcggcctaccagagtgtatctacaagaagttcaaggcaatcgccggggagaag
cctccgtgtgatgagtgtatagagaaccagtggctcttttga

DBGET integrated database retrieval system