KEGG   Tatumella citrea: A7K98_04610Help
Entry
A7K98_04610       CDS       T04873                                 

Definition
(GenBank) 23S rRNA (cytidine(2498)-2'-O)-methyltransferase RlmM
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
tci  Tatumella citrea
Brite
KEGG Orthology (KO) [BR:tci00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tci03009]
    A7K98_04610
Enzymes [BR:tci01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     A7K98_04610
Ribosome biogenesis [BR:tci03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    A7K98_04610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Spt5-NGN DUF4222 MIT_C
Motif
Other DBs
NCBI-ProteinID: ARU93136
UniProt: A0A1Y0L532
Position
987424..988527
Genome map
AA seq 367 aa AA seqDB search
MNKVLLYCRSGFEKECAAEITARATKLQVFGFARVKDNSGYVIFECYQYEDADKLIREIP
FQSLIFARQMIVVGELLRDLPQEDRISPIVGMLTGAVEKGGDLRVEVPDTNEAKELLKFC
RKFTVPLRAALRQNGILLNYESNKRPVVHVFFIASGTCYVGYSYPDNNSPLFMGIPRLKF
PSDAPSRSTLKLEEAFHVFVPADEWDERLASGMYAVDLGACPGGWTYQLVKRSMMVYAVD
NGPMAPALMDTGQVMHHREDGFKFRPPKSNISWLVCDMVEKPVRVASLMTEWLVNGWCRD
AIFNLKLPMKKRYEEVSQNLEMIEQALTAGGVNAQIQARQLYHDREEVTVHIRRIWSAHA
GRLDERG
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtattattatattgtcggtctggttttgaaaaagagtgtgcggcggaaatt
accgcgcgtgcgacaaaattgcaggtgtttggttttgccagagtgaaagacaactccggt
tatgtcatctttgaatgctatcagtatgaagatgccgataaactgatccgggagatccct
tttcagtcactgatatttgcccgacagatgattgtggtgggtgaactactgcgcgacctg
ccacaggaagaccgtatttcgccgatagtcggaatgctgaccggagccgtggaaaagggc
ggtgatctgcgggttgaagtcccggatactaatgaagcgaaagaactgctgaaattttgc
cgtaagtttacggtgccgctgcgtgcggcattacgacaaaatggtattttgcttaattat
gaaagcaataaacgcccggtagtacatgtattctttattgcttccggaacctgctatgtc
ggatattcttatccggacaataactcacctctgtttatgggcattccccggctgaagttc
ccgtcagatgcgccaagccgttctacgctgaaactcgaagaagcgttccacgtgtttgta
ccggcggatgaatgggatgagcggctggccagtggtatgtatgccgtggacctgggagct
tgcccgggtggctggacttatcaactggtgaaacgcagtatgatggtgtatgccgtggat
aatggcccgatggcgccggcactgatggataccgggcaggtcatgcatcaccgtgaagat
ggttttaaattccgcccgccaaaatcaaatatcagctggctggtgtgcgatatggtagaa
aaaccggtccgggtagcgtcactgatgacagaatggctggtgaatggctggtgccgtgac
gcgatttttaacctgaaactgccaatgaagaaacgctatgaggaagtttcacaaaacctg
gaaatgattgaacaggcgctgactgctggtggtgttaatgctcagattcaggcacggcag
ttatatcacgacagagaagaagtgacggtacatatccgtcgtatctggagtgctcacgct
gggcggctggatgagcgcgggtaa

DBGET integrated database retrieval system