KEGG   Tatumella citrea: A7K98_09525Help
Entry
A7K98_09525       CDS       T04873                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tci  Tatumella citrea
Pathway
tci00071  Fatty acid degradation
tci00280  Valine, leucine and isoleucine degradation
tci00310  Lysine degradation
tci00362  Benzoate degradation
tci00380  Tryptophan metabolism
tci00620  Pyruvate metabolism
tci00630  Glyoxylate and dicarboxylate metabolism
tci00640  Propanoate metabolism
tci00650  Butanoate metabolism
tci00900  Terpenoid backbone biosynthesis
tci01100  Metabolic pathways
tci01110  Biosynthesis of secondary metabolites
tci01120  Microbial metabolism in diverse environments
tci01130  Biosynthesis of antibiotics
tci01200  Carbon metabolism
tci01212  Fatty acid metabolism
tci02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A7K98_09525
   00630 Glyoxylate and dicarboxylate metabolism
    A7K98_09525
   00640 Propanoate metabolism
    A7K98_09525
   00650 Butanoate metabolism
    A7K98_09525
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A7K98_09525
   00072 Synthesis and degradation of ketone bodies
    A7K98_09525
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A7K98_09525
   00310 Lysine degradation
    A7K98_09525
   00380 Tryptophan metabolism
    A7K98_09525
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A7K98_09525
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A7K98_09525
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A7K98_09525
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tci04147]
    A7K98_09525
Enzymes [BR:tci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A7K98_09525
Exosome [BR:tci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A7K98_09525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ARU93994
UniProt: A0A1Y0LIX2
Position
2011879..2012997
Genome map
AA seq 372 aa AA seqDB search
MSAIIAALRTAVVPRGGAFNELLPHQLAELVIRALLSQTGIAAAEVSQLVMANSLGAGGN
PARVAALAAGLDHVSGLSIDTQCAGGLDAVALAAALVDAGTAEIVIAGGAESYSRRPLRA
KTFADQRPAEFYTRPSFTPDPEADPDMTMAAGELADRFHLTRQEQDQFAIDSHHKALAAA
SRLTAEIVPLAGVTGDVYPRALSLRLAQRTPALAGTVSLASTAVEADGAAFCVVVSDKTA
ARLGCGFALTVAGYQTLGADTRLPGYAPVEAIRRLFERNPQYQPQHCLTEMMEAYAAQAM
VCIRQSGLAMDNVNVGGGALARGHPIGASGAVLLCRMFHELRQRNGQTGLCAIAAAGGLG
SAMLLSPWGTQG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccatcattgcggccttacggactgcggtggttccgcgcggcggagcattcaac
gagttattgccccaccagctggcagaactggtgatccgcgctctgttatcgcagaccggc
attgctgctgcagaagtgtcgcagttagttatggcaaattcgctgggcgcgggcggtaat
ccggcacgggtcgccgcgctggctgccgggctggaccatgtttccgggctgagtattgat
acccagtgtgccggcggactggacgcggtagcgcttgccgcggcactggtcgatgcaggg
accgcagaaattgtgattgccggaggcgcagagagttattcacgtcgcccgctgcgggcc
aaaacatttgctgatcagcgacctgccgagttttatacccgcccgtcgtttacacccgat
cccgaagcggatccggacatgactatggctgccggtgaactggccgaccgttttcatctt
acgcggcaggaacaggaccagtttgctatcgacagtcatcataaagcgttagctgcggcc
agccggttaactgcagagattgtgccactggccggggtgaccggtgatgtctacccccgg
gctctcagcctgcggctggcacaacgcactccggcattagccggtacggtcagtctggcg
tccactgccgttgaagccgatggtgctgctttctgtgtggtggtttcggataagactgca
gcccgattaggctgtgggtttgctttaacagtcgcgggatatcagacgctgggggcagat
acccggttacccggttatgcgccggtggaagctattcgtcggttgtttgagcgtaatcct
cagtatcagccacaacactgtctaactgaaatgatggaagcctatgcagcgcaggccatg
gtttgtattcggcagagtggcctggcgatggacaatgtaaatgtcggaggaggggcactg
gccagaggccatccgattggtgcttcaggtgcggttctgttgtgcagaatgtttcatgaa
ctcagacaacgtaacgggcaaaccgggttatgtgctatcgcggcggccggagggctgggg
tcagcaatgctgctttccccgtggggaacacagggttaa

DBGET integrated database retrieval system