KEGG   Tatumella citrea: A7K98_10725Help
Entry
A7K98_10725       CDS       T04873                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
tci  Tatumella citrea
Pathway
tci00030  Pentose phosphate pathway
tci00480  Glutathione metabolism
tci01100  Metabolic pathways
tci01110  Biosynthesis of secondary metabolites
tci01120  Microbial metabolism in diverse environments
tci01200  Carbon metabolism
Module
tci_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
tci_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:tci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A7K98_10725
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A7K98_10725
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tci04147]
    A7K98_10725
Enzymes [BR:tci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     A7K98_10725
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     A7K98_10725
Exosome [BR:tci04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   A7K98_10725
  Exosomal proteins of colorectal cancer cells
   A7K98_10725
  Exosomal proteins of bladder cancer cells
   A7K98_10725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ARU94203
UniProt: A0A1Y0LJH3
Position
complement(2264021..2265496)
Genome map
AA seq 491 aa AA seqDB search
MSVTHQAQACDLVIFGAKGDLARRKLLPSLYQLEKAGQIHEDSRIIGVGRADWDKAAYTK
VVREALETFMKEKIDETLWDKLSNRLDFCNLDVNDSAHFVRLGKMLDQKKRTTINYFAMP
PNTFGAICKGLGQAKLNARPARVVMEKPLGTSLETSREINDSVGEYFEESQVFRIDHYLG
KETVLNLLALRFANSIFVNNWDNRTIDSVQITVAEEVGIEGRWGYFDQAGQMRDMIQNHL
LQILTMIAMSPPSDLGADSIRDEKVKVLRSLRRIDQTNVRDKTVRGQYTAGFVQGKKVPG
YLEEEGANKTSTTETFVSIRVDIDNWRWAGVPFYLRTGKRLPSKCSEVVVYFKNPELNLF
KDSYTELPQNKLTIRLQPDEGVAIEILNKVPGLDHKHKLQTTKLDLSFSETFNQSHLADA
YERLLLETMRGIQALFVRRDEVEAAWTWVDSIVEAWAVDGEGAKPYQAGTWGPVASVAMI
TRDGRSWNEFE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtaacccatcaggcccaggcatgtgatctggtcattttcggtgccaaaggtgat
ctcgcgcgccgcaagctgttgccatccctttatcagctggaaaaagccggacagatccat
gaagattcacgcatcattggtgtgggaagagcagactgggataaagctgcttacaccaaa
gtggttcgcgaagccctggaaacctttatgaaggaaaaaatcgatgaaacgctgtgggat
aaactcagcaatcgcctcgatttttgtaacctggatgtcaacgacagcgcccacttcgtc
cgtttaggaaagatgctggatcagaagaaacgtaccaccattaactactttgcaatgcca
ccgaatacctttggtgccatctgtaaagggctgggacaggcgaaactgaatgccaggcct
gcccgcgttgttatggagaagccactgggtacctcgctggaaacttcccgtgaaatcaac
gacagtgttggtgagtactttgaagagagccaggttttccgtatcgaccactatctgggc
aaagagaccgtactgaatctgctggcactgcgttttgcaaactcaatcttcgttaacaac
tgggataaccgcactattgatagtgtgcaaatcaccgttgctgaagaagtgggcattgaa
ggtcgctggggttatttcgaccaggcaggtcagatgcgggatatgattcagaaccacctg
ttgcagattctgacaatgatcgcgatgtctcctccatccgatctgggtgccgacagtatc
cgtgatgagaaagttaaagtgctgcgctctctgcgccgtatcgatcagactaacgtccgt
gataagacagtacgcggccagtatactgctggttttgttcagggcaaaaaagtgcctggc
tatctggaagaagagggtgctaataaaaccagtaccacagaaacgtttgtttctatccgg
gtggatattgataactggcgttgggctggcgtaccgttctatctgagaaccggcaaacgt
ctcccgtccaagtgctctgaagttgtggtttatttcaaaaaccctgaactgaacctgttc
aaagattcctacacagaactgcctcagaacaagctgactattcgtctgcaacccgatgaa
ggtgttgctatcgagattctgaataaagtgccggggctggatcacaaacacaaacttcag
accaccaagctggatctgagtttttcagagaccttcaaccagtcgcacctggctgatgcc
tatgagcgtctgttgctggaaactatgcgcggcattcaggcactgtttgtgcgtcgtgac
gaagttgaagcagcctggacctgggttgactccatcgttgaagcatgggcagtagacggt
gaaggtgctaaaccttatcaggcaggaacctgggggccagtggcttccgtggctatgatc
acccgtgacgggcgttcatggaatgaattcgagtaa

DBGET integrated database retrieval system