KEGG   Tatumella citrea: A7K98_14380Help
Entry
A7K98_14380       CDS       T04873                                 

Definition
(GenBank) bifunctional UDP-glucuronic acid oxidase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
tci  Tatumella citrea
Pathway
tci00520  Amino sugar and nucleotide sugar metabolism
tci01100  Metabolic pathways
tci01503  Cationic antimicrobial peptide (CAMP) resistance
Module
tci_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:tci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A7K98_14380
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    A7K98_14380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:tci01005]
    A7K98_14380
Enzymes [BR:tci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     A7K98_14380
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     A7K98_14380
Lipopolysaccharide biosynthesis proteins [BR:tci01005]
 Unusual sugar
  A7K98_14380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd Formyl_trans_N Formyl_trans_C 3Beta_HSD NAD_binding_10 NAD_binding_4 TrkA_N DUF5338 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: ARU94835
UniProt: A0A1Y0LLD7
Position
3031744..3033726
Genome map
AA seq 660 aa AA seqDB search
MKAIVFAYHDMGCVGIEALIDAGYQITAIYTHLDNPGENHFFGSVAHLAAEHNIEVFSPE
NVNHPLWIERIKQSAPDIIFSFYYRDLICDEILSIPQQGAFNLHGSLLPRYRGRAPLNWV
LVNGETETGVTLHKMVHRADAGDIAAQYKVAIEPTDDALRLHKKLTRTARELLNEQLPLI
KNGQLKLTPQDESKATYVGRRTPEDGRLDWNRSAAELHNLVRAVSEPWPGAFSFSGTTRF
IVWKSRVRQDLPAAIPGKVLATAPLTIATAQGALEVVTGQTDNSVYMQGNELAKTLGLVE
GAVLSSQPVTRDKKRTRVLILGVNGFIGNHLTERLLQDDNYEIYGMDIGSDAVSRFLAND
RFHFVEGDITIHSEWIDYHIKKCDVVLPLVAIATPVEYTRNPLRVFELDFEENLKIIRGC
VKHKKRIIFPSTSEVYGMCTDKTFDEDNSNLVVGPINKQRWIYSVSKQLLDRVIWAYGEK
ENLRFTLFRPFNWMGPRLDSLNSARIGSSRAITQLILNLVEGSPIKLIDGGAQKRCFTDI
SDGIEALFRIIENKNGQCDGQIINIGNPENEASIRELAEMLYRCFERHPLRHHFPPFAGY
REVESSSYYGKGYQDVEHRKPDIRNARRLLGWTPETEMETTVEQTLDFFLRTVITSDNTP
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctatagtcttcgcttatcacgacatgggatgcgtcggtattgaagcgctgatt
gacgccgggtatcagataacggcaatttacacccacctggataatcctggtgagaatcat
ttctttggttcggtcgcccatctggcggcggaacataatattgaagttttttcgccggaa
aacgtcaatcatcctctgtggatagagcggattaaacaaagtgctcctgacatcattttt
tccttttactaccgtgatttgatttgtgatgaaatcctgtcaatcccacaacagggtgca
tttaatctgcatggctcactgctcccccgttatcgtgggcgtgcgccgttaaactgggta
ctggttaatggtgaaaccgaaaccggcgtgactctgcataaaatggtacatcgtgccgat
gccggtgatatcgcagcccagtataaagttgctattgaacccaccgatgatgcattgcgt
ctgcacaaaaaactaacccgtacagcacgggaattgctaaacgaacagctacctttaatc
aaaaacggccaactgaagttgactccgcaggatgaaagtaaagccacctatgtcggtcgc
agaaccccggaagatggacggctggactggaaccgtagtgcggccgagctccataatctg
gttcgggcagtcagtgaaccctggcctggagctttcagtttttcaggaaccacccggttt
attgtctggaaatcccgtgttcgtcaggacctgccagcagccattccgggcaaagtgctt
gctaccgcaccgctgactattgccaccgctcagggtgcgcttgaagtcgttaccggtcag
actgataacagtgtgtatatgcagggtaacgagctggcaaaaactctgggtctggtagaa
ggtgcagtgttaagcagccagccagtgacccgcgataaaaaacgtacccgggtactgatt
ctgggtgtaaatggctttatcggtaatcatctgactgagcgcctgctgcaggacgataat
tacgaaatctatggtatggatatcggctctgatgctgtatcccgttttctggctaacgac
agattccattttgtcgaaggtgatatcaccattcattcagaatggatcgattaccacatc
aaaaaatgtgatgtcgtgttgcctctggtagctattgccactccggttgaatatacccga
aatccgttacgggtctttgagctcgattttgaagaaaacctgaaaattatccgtggttgt
gtaaaacataaaaaacgcataattttcccatccacttctgaagtttatggaatgtgtact
gataaaacctttgatgaagataattcaaatctggtggtcggtcctatcaataaacagcgt
tggatttattcggtctctaaacagctgctggatcgcgtaatctgggcttatggcgaaaaa
gaaaacctgcgcttcaccctgttccgtccgttcaactggatgggacctcgtctggacagc
ctgaattcagcacgtattggtagttcccgtgccattactcagttaatcctgaatctggta
gaaggttcgcctattaaactgattgatggcggagctcagaaacgttgcttcaccgacatc
agcgacggtattgaagctctgttccggattatcgagaataaaaatggtcagtgtgatggt
cagatcatcaatataggtaatcccgagaacgaagcaagtatcagagagctggcagaaatg
ctgtatcgctgctttgaacgccatccgctgcgtcatcatttccctccatttgcaggttac
cgtgaagtggaaagcagcagctactacggcaaaggttaccaggatgtcgagcaccgtaaa
ccagatatccgtaatgcccgtcgcctgttgggatggacacctgagaccgaaatggaaact
acggtagagcaaacgctggatttcttcctgcgcactgtgattacgtcggataatactcca
tga

DBGET integrated database retrieval system