KEGG   Tatumella citrea: A7K98_17470Help
Entry
A7K98_17470       CDS       T04873                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
tci  Tatumella citrea
Pathway
tci00561  Glycerolipid metabolism
tci00640  Propanoate metabolism
tci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A7K98_17470
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    A7K98_17470
Enzymes [BR:tci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     A7K98_17470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ARU95372
UniProt: A0A1Y0LBE2
Position
complement(3708272..3709354)
Genome map
AA seq 360 aa AA seqDB search
MFSVKSPQNYLQRAGLLAQAGELIRPQAGYLRILTSPRAWQAVNPQLIHSLEQAGIRWET
EYLQGECTEQAVADFRDNVRQQGADGILAVGGGRVLDTAKAANEALGDRRLFTVPTLAAT
CAAWSPLAIIYNSQGGHLSSNELSEMPALILVDSAVIAASDPRYLRSGIVDALAKWYEFE
PFQRKNPHLLALDLKVAAARQATDIFLRQGHAAVVANQSQQVTEDLEKVIEANIALAGLA
NSVRGSLATPGVAHVIHDTLTHQPELHHWLHGEKVGFSLLLQSLLDNDLQQPDSQLLSLL
RQFGTPLRLPALQGDRAARLYQIAHQIRFPAGSLDDLPFAVTSTALLRALQLTETTDYSV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtttagcgtaaaatctccgcaaaattatctgcaacgggcaggtcttctggcacaggct
ggtgagctgattcggccacaggccggttatctgaggatactgacttctccccgcgcctgg
caggcggtaaacccacagctgatccatagcctggaacaggcagggattcgctgggagacc
gaatatttacagggtgagtgtactgaacaggcggtagctgacttccgtgacaatgtcagg
cagcagggagcggatggcattctggcggtcggcggtggccgggtactggataccgctaaa
gcagcgaacgaggccctgggggatcgtcggctatttaccgtacccactctggcagcaacc
tgtgcagcctggtcaccgttagcgattatttataattcacagggtggtcacctgagcagt
aatgaactgtcagaaatgccggcacttattctggtggacagtgctgttattgctgcgtca
gatccgcgttatttgcgttccggcatcgtagatgcattagcaaaatggtatgagttcgaa
ccctttcagcggaaaaatcctcacttgctggctttggatttaaaagtggcggcagctcgt
caggccactgatatttttctgcgccagggacatgcggcagtggtcgctaatcagtcgcag
caggtcactgaagatcttgagaaggtgatcgaagcgaatattgccctggccggactggca
aacagtgtccgtggctcgctggcgacccccggggttgcgcatgtgattcatgatacgttg
acccatcagcctgagcttcatcactggctgcacggggaaaaggttggcttcagcctgcta
ctccagtcattgctggataacgatctgcagcagcccgactcgcagttgctcagcctatta
cggcagtttggtaccccactgcgcctgccggcattgcagggtgacagggcagccagactg
tatcagattgcgcatcagattcgttttccggctggcagcctggatgatttaccgtttgca
gtgacatccacggctttattacgggccctgcaactcaccgaaactacagattattccgtc
tga

DBGET integrated database retrieval system