KEGG   Tatumella citrea: A7K98_20865Help
Entry
A7K98_20865       CDS       T04873                                 

Definition
(GenBank) glucose-1-phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
tci  Tatumella citrea
Pathway
tci00010  Glycolysis / Gluconeogenesis
tci01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A7K98_20865
Enzymes [BR:tci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     A7K98_20865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like Hydrolase Acid_PPase PNK3P SHOCT
Motif
Other DBs
NCBI-ProteinID: ARU95943
UniProt: A0A1Y0LD37
Position
4456571..4457176
Genome map
AA seq 201 aa AA seqDB search
MLYIFDLGNVIVDIDFNRVLGVWSHLSGVPLALLQNRFTFDEAFEQHERGEISDQQFAEL
ICKTLEVNLSYDQFAAGWQAVFVGVRDDTVAQMNALRAAGHRVVILSNTNNLHCEFWPQQ
YPEVSSAADAIYLSQQLKMRKPEPGIYQAVLEKEGVAASEVVFFDDNESNINAARQAGIH
SVLVTGPETVRQWFATSGVHS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgctttacatctttgatttgggtaatgtcatcgttgatatcgattttaatcgtgtactg
ggcgtctggagccacttaagtggggtgcctttagcgctgctgcaaaatcgttttaccttc
gatgaagcttttgaacagcacgaacgtggtgagatatccgatcaacagtttgcagaactc
atctgcaaaacactggaagtgaatctgagttatgaccagtttgctgcaggatggcaggcg
gtttttgtcggtgtgcgtgatgacacagtcgcgcagatgaatgcattacgcgctgcagga
caccgggttgtcattctgtcgaataccaataatctgcactgtgaattctggcctcagcag
tatccggaggtgagctctgcagcagacgcaatttatctctctcagcaattgaaaatgcgt
aaacctgagcccgggatctaccaggcagtgctggagaaagaaggagtcgctgccagcgag
gtcgtgttctttgacgataatgagtccaatatcaatgcggcccgtcaggcaggaatccac
agcgtactggtcacaggaccggagactgtccggcagtggtttgccacctccggagtacac
tcctga

DBGET integrated database retrieval system