KEGG   Thauera chlorobenzoica: Tchl_1347Help
Entry
Tchl_1347         CDS       T04612                                 

Definition
(GenBank) Glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
tcl  Thauera chlorobenzoica
Pathway
tcl00270  Cysteine and methionine metabolism
tcl00480  Glutathione metabolism
tcl01100  Metabolic pathways
Module
tcl_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:tcl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Tchl_1347
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Tchl_1347
Enzymes [BR:tcl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     Tchl_1347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: APR04206
UniProt: A0A1H5T7N3
Position
1420738..1421694
Genome map
AA seq 318 aa AA seqDB search
MSRPLKLVFILDPLDGLQAYKDSSIAMMRAAARRGHQVWALQRAGLTWREGGVVGTACVP
LSLHDDDRDWYRTGAAEARPLAAFDAVLMRQDPPFDFEYVTATWLLERAVQAGVRVFNDP
RAVRDHSEKIAITEFPQFTATTLVARDPADIHAFIDELGDVILKPLDGMGGSQIFRVRAD
DPNRNVIVETLAQDGTRTIMAQRYLPQIVDGDKRVLIIGGEVVPYALARIPKAGETRGNL
AAGGRGVAMALTAREREIAEFLAPILWARGLLIVGLDVIGGHLTEINVTSPTCMVEIAAQ
QGFDVAARVIEALEQACG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcccgctcaagctcgttttcatcctcgacccgctcgacggcctgcaggcctac
aaggactccagcatcgccatgatgcgtgccgccgcccgccgcggccaccaagtgtgggcg
ctgcagcgtgccgggctcacctggcgcgagggtggggtggtgggcaccgcctgcgtgccg
ctgagcctgcatgacgacgaccgcgactggtaccgcaccggcgccgccgaggcgcggccg
ctggccgcgttcgacgccgtgctgatgcgccaggacccgcccttcgatttcgaatacgtc
accgccacctggctgctcgagcgcgcggtgcaggccggggtgcgcgtgttcaacgacccg
cgcgcggtgcgcgaccactccgagaagatcgcgatcaccgaattcccccagttcaccgcg
accaccctggtggcgcgcgacccggccgacatccacgccttcatcgacgagctcggcgac
gtcatcctgaagccgctcgacggcatgggcggcagccagatcttccgcgtgcgcgccgac
gaccccaaccgcaacgtcatcgtcgagaccctcgcccaggacggcacgcgcacgatcatg
gcgcagcgctacctgccccagatcgtcgacggcgacaagcgcgtgctgatcatcggcggt
gaagtcgtgccctatgcgctcgcgcgcatcccgaaggcgggcgagacgcgcggcaacctc
gccgccggcgggcgcggggtggcgatggcgctgaccgcgcgcgagcgcgagatcgccgaa
ttcctcgctccgatcctgtgggcgcgcggcctgctgatcgtcggcctcgacgtgatcggc
ggccacctcaccgagatcaacgtcaccagccccacctgcatggtcgagatcgccgcgcag
cagggcttcgacgtcgctgcgcgggtcatcgaggcgctggagcaggcatgcggctga

DBGET integrated database retrieval system