KEGG   Thauera chlorobenzoica: Tchl_2175Help
Entry
Tchl_2175         CDS       T04612                                 

Definition
(GenBank) phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
tcl  Thauera chlorobenzoica
Brite
KEGG Orthology (KO) [BR:tcl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Tchl_2175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: APR05018
UniProt: A0A1H5S1A5
Position
2355268..2356848
Genome map
AA seq 526 aa AA seqDB search
MDLQQISELERAARTGRGELLRLGIGVLFIVGVMFYAGMRGNGETSLILVMAAMIGGYMA
MNIGANDVANNVGPAVGSRALSLAGALVIAAVFEAAGALIAGGEVVGTIRNGIIDPDLIP
DADTFVWIMLAALLAGALWLNIATAVGAPVSTTHSIVGAVLGSGMAAAGPAIVDWATMGN
IAASWVVSPLLGGLFAAGFLYLVKRSITYQPDMAEAARRMVPLLVGLMAWTFATYLILKG
LNKVWKVGFVAALGYGFVVGIGVTLLVRKLVSGRSGIVANTKQSVNRLFTVPLIFAAALL
SFAHGSNDVANAVGPLAAIVDVVTHEGVISKAAAIPTWVMMVGAVGIALGLALFGPKVIR
TVGSEITELDQMRAYCIAMAATITVIVASQFGLPVSSTHIAVGGVFGVGFLREYLKSNYD
RMLSEIKAHHPEGDQVAIEGFIARFEKASVEEKGVMLRDLKERSKNAEDPAHFSKGERKN
LKKVYRRELVKRSQLLRIAAAWVITVPASALMAAILFFTIRGMMVS
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgcagcaaatcagcgaactcgagcgcgccgcccgaacggggcggggtgaatta
ctgaggctcgggatcggcgtcctcttcatcgtcggggtgatgttctatgccggtatgcga
ggcaacggcgaaaccagtctgatcctggtgatggcggcgatgatcggcggctatatggcg
atgaacatcggcgccaacgacgtcgccaacaacgtcggcccggcggtcggctcgcgggcg
ttgagcctggccggcgccctggtgatcgccgccgtgttcgaggccgccggcgcgctgatc
gccggtggcgaagtggtcggcaccatccgcaacggcatcatcgaccccgatctcatcccc
gacgccgacactttcgtctggatcatgctcgccgcgctgctcgccggcgcgctgtggctg
aacatcgccaccgcggtgggagcgccggtgtcgacgacgcactcgatcgtcggtgccgtg
ctcggctcgggcatggcggcggccggtcctgccatcgtcgactgggcgacgatgggcaat
atcgcggcgagctgggtggtttcgccgctgctcggcggcctgttcgccgccggcttcctg
tacctggtcaagcgcagcatcacctaccagcccgacatggccgaagccgcgcgccggatg
gtgccgctgctggtcgggctgatggcgtggacgttcgccacctacctgatcctgaaaggc
ctcaacaaggtgtggaaggtgggcttcgtcgccgcgctcggctatggcttcgtcgtcggc
atcggcgtcaccctgctggtgaggaagctggtgtcggggcgaagcggcatcgtcgccaat
accaaacagagcgtgaaccggctgttcaccgtgccgctgatcttcgccgcggcgctgctc
agcttcgcccacggctcgaacgacgtcgccaacgcggtcgggccgctggcggcgatcgtc
gatgtcgttacccacgagggcgtcatcagcaaggcggcggcgatccccacctgggtgatg
atggtcggtgcggtcgggattgcgctcgggctggcgctgttcggccccaaggtgatccgc
acggtgggctcggagatcaccgagctcgaccagatgcgggcctattgcatcgcaatggca
gcgacgatcacggtgatcgtcgccagccagttcggcctgccggtcagctcgacccacatc
gcggtgggcggggtgttcggggtgggctttctgcgcgagtacctcaagagcaattacgac
cggatgctgtccgagatcaaggcgcaccaccccgaaggcgatcaggtggcgatcgaaggc
ttcatcgcgcgcttcgaaaaagcctcagtggaagaaaaaggggtgatgctgcgcgatctc
aaggagcgttcgaagaacgccgaggaccccgcgcatttttccaagggcgagcgcaagaac
ctgaagaaggtctaccgccgcgagctggtcaagcgttcgcagctgctgcgcatcgccgcc
gcctgggtgatcaccgtgccggcctcggcgctgatggcggcgatcctcttcttcaccatc
cgcggcatgatggtgtcttga

DBGET integrated database retrieval system