KEGG   Thauera chlorobenzoica: Tchl_3242Help
Entry
Tchl_3242         CDS       T04612                                 

Definition
(GenBank) coenzyme A biosynthesis bifunctional protein CoaBC
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
tcl  Thauera chlorobenzoica
Pathway
tcl00770  Pantothenate and CoA biosynthesis
tcl01100  Metabolic pathways
Module
tcl_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:tcl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Tchl_3242
Enzymes [BR:tcl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Tchl_3242
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     Tchl_3242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein DrsE PALP
Motif
Other DBs
NCBI-ProteinID: APR06048
UniProt: A0A1H5TQA1
Position
complement(3501103..3502299)
Genome map
AA seq 398 aa AA seqDB search
MNILHGRKIILGVSGGIAAYKAAELVRLLGKAGADVHVVLTAAGARFVTPVTFQALSGNP
VWSDLWDARVANNMAHIDLGRNADAILVAPATADFIARLAHGLADDLLSTLCLARDAPLI
VAPAMNRQMWESPPTQRNMALIRSDGVTVFNPAAGEQACGETGMGRMLEAEGILEHLEGF
FAPKLLAGRKVVLTAGPTFEAIDPVRGITNTSSGKMGYALARACAQAGAEVVLVSGPVSL
SVPAQVCCVAVVSALQMRAAVAEALPGADVFIGVAAVADYRVQDVAEHKIKKSGDALSLS
LVPNPDILAEVAARADAPFCVGFAAESRDLDTYAEGKRRSKRLPMVVGNLIGDGMGGEDN
TVVLYDDAGRHPLARAPKAEVARAIVTHLAALLAQSGR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatattctgcatggcaggaagatcatacttggcgtttcgggagggatcgcggcctac
aaggcggccgagctcgtccgcctgctgggcaaggccggtgccgatgtgcacgtggtgctg
accgccgccggggcgcgtttcgtgaccccggtgacgttccaggcgctgtccggcaacccg
gtgtggtccgacctctgggacgcgcgcgtggcgaacaacatggcgcacatcgatctcggg
cggaacgccgatgcgatcctggtggcgccggcgacggcggatttcatcgcccgtctcgcc
cacggtctggccgacgacctgctgagcacgctgtgcctggcgcgcgatgcgccgctgatc
gtcgcgcccgcgatgaaccggcagatgtgggagtcgccgccgacgcagcgcaacatggca
ctgatccgcagcgacggggtcaccgtcttcaaccccgcagccggcgaacaggcctgcggc
gagaccgggatggggcggatgctcgaggccgaaggcattctggagcacctcgaagggttc
ttcgcgccgaagctgctggccggacgcaaggtcgtgctgaccgccgggccgaccttcgag
gcgatcgacccggtgcgcgggatcaccaacaccagttcggggaagatgggctacgcgctg
gcgcgcgcctgcgcccaggccggcgccgaagtggtgctggtcagtgggccggtgagcctg
tcggtgccggcgcaggtgtgctgtgtggcggtcgtcagtgcgctgcagatgcgcgcggcg
gtggccgaggccttgcccggcgccgacgtgttcattggcgtggcggcggtggccgattac
cgggtgcaggacgtggcggagcataagatcaagaaaagcggcgatgcgctgagcttgtcc
ctggtgccgaacccggacattctggccgaagtggcggcgcgtgccgatgcgccgttctgc
gtcgggttcgcggcggagagccgtgacctcgacacctatgccgaaggcaagcgacggagc
aagcgcctgccgatggtggtgggcaacctgatcggtgacggcatgggcggcgaggacaac
accgtcgtcctctacgacgatgccggccggcacccgctggcgcgcgcgccgaaggcggag
gtggcgcgcgcgatcgtcacccacctcgcggcgttgctcgcgcagtccgggcgttga

DBGET integrated database retrieval system