KEGG   Thauera chlorobenzoica: Tchl_3421Help
Entry
Tchl_3421         CDS       T04612                                 

Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tcl  Thauera chlorobenzoica
Pathway
tcl00071  Fatty acid degradation
tcl00072  Synthesis and degradation of ketone bodies
tcl00280  Valine, leucine and isoleucine degradation
tcl00310  Lysine degradation
tcl00362  Benzoate degradation
tcl00380  Tryptophan metabolism
tcl00620  Pyruvate metabolism
tcl00630  Glyoxylate and dicarboxylate metabolism
tcl00640  Propanoate metabolism
tcl00650  Butanoate metabolism
tcl00900  Terpenoid backbone biosynthesis
tcl01100  Metabolic pathways
tcl01110  Biosynthesis of secondary metabolites
tcl01120  Microbial metabolism in diverse environments
tcl01130  Biosynthesis of antibiotics
tcl01200  Carbon metabolism
tcl01212  Fatty acid metabolism
tcl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tcl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tchl_3421
   00630 Glyoxylate and dicarboxylate metabolism
    Tchl_3421
   00640 Propanoate metabolism
    Tchl_3421
   00650 Butanoate metabolism
    Tchl_3421
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Tchl_3421
   00072 Synthesis and degradation of ketone bodies
    Tchl_3421
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tchl_3421
   00310 Lysine degradation
    Tchl_3421
   00380 Tryptophan metabolism
    Tchl_3421
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tchl_3421
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tchl_3421
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Tchl_3421
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tcl04147]
    Tchl_3421
Enzymes [BR:tcl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Tchl_3421
Exosome [BR:tcl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tchl_3421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Gly_rich_SFCGS
Motif
Other DBs
NCBI-ProteinID: APR06221
UniProt: A0A1H5YUC1
Position
complement(3684226..3685422)
Genome map
AA seq 398 aa AA seqDB search
MTTSENDIVAISVARTPLGSFGGSLREVPVWELGAIAIRAALERAALPGDQIDQMIFANC
RQAGNGPNPARTAAVKGGIPVEAPSFTVNMACPSGMKSVMLAAQELASGNARFIVAGGME
SMSTMPYLLKNVRWEGFKLGDKTLLDGWADTFDPLCGCGMGMTAENLVSKYGITREEMDE
FALASHDGAAKAQRGGFTASEIVPVTLPATRTQDEVTLSLDEAIRPDTCLESLAKLKPVF
KKDGSVTAGNACSMGDGACAIVLTTRAIAKSLGRSPMFSLVASAQTAVEPAYMGEGPGRA
IPMVLKKAGMTLSDIDFIEVNEAFAAQVLANERALRWDRAKVNVYGGAIALSHPTGMSGA
RLLMTLGNILQRENGELGVASICGGGGVTTAIVIRRES
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccagcgaaaacgatattgttgcaatcagcgtcgctcgcacaccgcttggcagt
tttggcggcagcttgcgcgaagttcctgtatgggagctgggtgcgatcgctattagggcg
gctcttgagcgtgccgcactgcccggcgatcagatcgaccagatgatctttgccaactgt
cggcaggcgggaaatggtcccaaccctgcgcgcactgcggcggtgaagggtggcatcccg
gttgaagcgccttccttcacagttaatatggcctgcccctcgggcatgaaatccgtgatg
ctcgccgcccaggagcttgccagcggtaatgctcgattcattgttgccgggggcatggag
tcgatgagcactatgccgtacctgctgaagaacgtgcgctgggaagggttcaagctcggt
gacaagaccctgcttgacggctgggcggatacgttcgatccattgtgcggctgtggcatg
ggcatgacggcggagaatcttgtgtccaagtacggcatcacccgcgaggaaatggacgag
tttgcgctcgcctcgcacgatggagcggccaaggcgcagcgaggcgggttcaccgcgagc
gagattgttcctgtgacgttgccggcaacacgaacccaggacgaagtgaccctttcgctt
gacgaggcgattcggccagacacctgcttggagagcttggcgaagctcaaaccggtcttc
aagaaggatggcagcgtgacggcaggcaacgcctgcagcatgggcgatggcgcttgcgca
atcgtgctgaccacgcgcgctatcgccaaatccctgggacgctcgcccatgttttccctg
gtggcgtcggcgcagactgcagtagagcctgcctacatgggcgaagggcccggtcgtgcg
attcccatggtattgaaaaaggcaggcatgacgctgagcgacattgacttcattgaggtc
aacgaggcattcgctgcacaggtgctggcgaacgagcgcgcgctccgctgggaccgagcc
aaggtcaacgtatacgggggggcgattgctctcagccacccgacaggtatgtccggtgca
cggttgttaatgacgctcggcaacatattgcagcgcgagaacggcgaactgggcgtagcg
tcgatctgcggtggcggcggggtcaccaccgccatcgtgatccgccgcgaatcttga

DBGET integrated database retrieval system