KEGG   Thermobacillus composti: Theco_0060Help
Entry
Theco_0060        CDS       T02394                                 

Definition
(GenBank) ABC-type sugar transport system, ATPase component
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
tco  Thermobacillus composti
Pathway
tco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:tco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Theco_0060
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tco02000]
    Theco_0060
Enzymes [BR:tco01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     Theco_0060
Transporters [BR:tco02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    Theco_0060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N SbcCD_C AAA_25 RsgA_GTPase AAA_29 AAA_30 AAA_22 AAA_23 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AGA56317
UniProt: L0E973
Position
72444..73952
Genome map
AA seq 502 aa AA seqDB search
MSENRPMLQMSGIHKRFPGVHALNDVRFRMFAGEVHALMGENGAGKSTLIKVLTGVYPVD
EGSVEWEGRPLHLRSPLEAQQAGISTVYQEINLCPNLSVAENIFIGREPRKFGKISWKAM
NRAAEALLAERLNVKLDVTKPLDTYSVAVQQLVAIARALNISARLLILDEPTSSLDRDET
NKLFEVMRHLKKQGLAILFVTHFLDQVYEVSDRITILRNGRFVGEYLTDELPRVELVQKM
IGKDLELLGGMPKRTAAPGEAKPPYLRASGLGRKGGVEPFDLTIGSGEIVGLAGLLGSGR
TETARLLFGADRADQGRLVIEGREIRLDSPRKAIDRGIAFCSENRKTEGIIEDLTVRENI
ILALQAHRGWFRALSRRRQEEIADEYIRALDIKPPDPEQFIRNLSGGNQQKVILARWLLM
NPRLLILDEPTRGIDVGAKAEIQKLVLSLSGEGMAVLFISSELEEVVRVSSRIAVLRDRR
HVRHLTGDDIQQTTIMQAIAGG
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaaccgaccgatgctgcaaatgtccggcatccacaagcggttccccggcgtc
cacgcgctgaatgacgtccgtttccggatgttcgccggcgaagtgcacgccttgatggga
gagaacggcgccggcaaatcgacgctgatcaaggtgctcaccggcgtctatcccgttgac
gaaggctcggtggaatgggagggcaggccgctgcatctgcggagtccgctcgaagcgcag
caggccggaatcagcacggtctatcaggaaatcaatctgtgtccgaacctgtccgtggcc
gagaacatcttcatcggccgggaaccgcggaaattcggcaagatttcatggaaagcaatg
aaccgcgcagccgaggcgctgcttgcggaacggctcaacgtgaagcttgacgtgaccaag
ccgctggacacctattctgtcgccgttcagcaactggtcgcgatcgcccgagccctcaac
atttcggcccggctgctcatcttggacgaaccgacctcctccctcgaccgggacgagacg
aacaagctgttcgaggtcatgcgccatctcaagaagcaagggctggccatcctgttcgtc
acccattttctcgaccaggtctatgaagtgtccgatcggattacgattctgcggaacgga
cggttcgtcggcgaatacctgaccgatgaactgccccgcgtggagctggtgcagaagatg
atcggcaaggatctggaacttctcggcggcatgccgaaacggaccgccgcgccgggcgag
gcgaagccgccctatctgcgcgcatccgggctgggacgcaagggcggcgtggagccgttc
gatctgacgatcggcagcggcgagatcgtcggactggccgggctgctcggatcggggcgg
acggagacggcccggctgctgttcggcgccgaccgcgccgatcagggaaggctcgtcatc
gagggccgggagatacggctggactcgccgcgcaaagcgatcgaccggggcatcgccttc
tgttcagagaaccgcaagaccgaggggattattgaagatttgaccgtgcgggagaacatc
attctggcgctgcaggcccatcgcggctggttccgcgcgctgtcccgcagacggcaggag
gaaatcgccgacgaatatatccgggcgctcgacatcaagccgcccgatcccgaacagttc
atccgcaatctgtccggcggcaaccagcagaaagtgatcctcgcccgctggctgctcatg
aatccccggctgctcattctggatgagccgacgcggggcattgacgtcggcgccaaagcc
gagattcagaagctggtcctgtccttgtccggagaagggatggccgtgctcttcatctcc
tccgagctggaagaagtcgtccgcgtcagcagccggatcgccgtcctgcgcgaccggcgg
catgtgcggcacttaaccggtgacgacatccaacagacgaccattatgcaggccatcgcg
ggaggatga

DBGET integrated database retrieval system