KEGG   Thermobacillus composti: Theco_0414Help
Entry
Theco_0414        CDS       T02394                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tco  Thermobacillus composti
Pathway
tco00071  Fatty acid degradation
tco00072  Synthesis and degradation of ketone bodies
tco00280  Valine, leucine and isoleucine degradation
tco00362  Benzoate degradation
tco00380  Tryptophan metabolism
tco00620  Pyruvate metabolism
tco00630  Glyoxylate and dicarboxylate metabolism
tco00640  Propanoate metabolism
tco00650  Butanoate metabolism
tco00900  Terpenoid backbone biosynthesis
tco01100  Metabolic pathways
tco01110  Biosynthesis of secondary metabolites
tco01120  Microbial metabolism in diverse environments
tco01130  Biosynthesis of antibiotics
tco01200  Carbon metabolism
tco01212  Fatty acid metabolism
tco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Theco_0414
   00630 Glyoxylate and dicarboxylate metabolism
    Theco_0414
   00640 Propanoate metabolism
    Theco_0414
   00650 Butanoate metabolism
    Theco_0414
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Theco_0414
   00072 Synthesis and degradation of ketone bodies
    Theco_0414
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Theco_0414
   00310 Lysine degradation
    Theco_0414
   00380 Tryptophan metabolism
    Theco_0414
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Theco_0414
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Theco_0414
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Theco_0414
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tco04147]
    Theco_0414
Enzymes [BR:tco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Theco_0414
Exosome [BR:tco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Theco_0414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGA56635
UniProt: L0EBT6
Position
422045..423229
Genome map
AA seq 394 aa AA seqDB search
MSEAVIVSAVRTPIGKFMGSLQDVPAARLGEIVIRAAVERAGIDPASVDEVIMGNVLQAG
EGQNPARQAALAAGLPQETPAVTINKVCGSGLKAVQLAWQAIRCGDLTTVVAGGMENMSR
APFLVREARGGLRMGHRALVDSMISDGLWCAIGDHHMGITAENLCERAGLTREELDRFAW
ESQRKAAEAIGAGRFREEIVPVDIPARGGKTVRFEADEYPRPDTTLEALGALRPAFRPDG
LVTAGNASGINDGAAAAVIMSAEKARALGLKPMAVIRSVASAGVDPAVMGLGPVPAVRKA
LARAGIGLADVGLAELNEAFAAQMLACRKELELDPAIVNVNGGAIALGHPIGASGARILV
TLLHEMARRKVRYGLAALCIGGGQGIAAVVERPD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagcggttattgtaagcgctgtccgaacgccgatcggcaagttcatgggcagt
ctgcaggatgtgccggcggcgcggctcggcgagatcgtcatccgggcggcggtcgaacgg
gccgggatcgatcccgcgtcggtcgacgaagtgatcatgggcaacgtcctgcaggccggc
gaaggacagaatccggcgcgccaggccgccctggcggcagggctgccgcaggagacgccg
gccgtcaccatcaacaaggtttgcggctcagggttgaaggcggtgcaactggcctggcag
gcgatccggtgcggcgatctgacgacggtcgtcgccggcggcatggagaacatgagccgg
gccccctttcttgtccgggaagcgcgcggcggcctgcgcatggggcaccgggcgctcgtc
gacagcatgatcagcgacggcctgtggtgcgccatcggcgaccatcacatgggcatcacc
gcggagaacttgtgcgagcgggcaggcctgacccgggaggagctggaccggttcgcctgg
gaaagccagcggaaggccgccgaagcgatcggggccgggcggttccgcgaggagatcgtg
ccggtggacattccggcgcgcggcggcaagacggtccggttcgaagcagatgaatatccg
cggccggacacgacattggaggcgctgggcgcgctgcgcccggcgttcaggccggacggc
ctggtgaccgcgggcaacgcctcgggcatcaatgacggagccgcggcggccgtcatcatg
agcgcggagaaggcgcgggcgctcgggctgaagccgatggcggtcatccggtccgtcgct
tcggcgggcgtcgatccggccgtcatggggctggggcccgtgcccgccgtccgcaaggcg
ctggctcgggccgggatcggcctcgccgatgtcggcctcgccgaactgaacgaagcgttc
gccgcccagatgctcgcctgccggaaggaactggagctcgatccggccatcgtgaatgtg
aacggcggcgccatcgccctgggccatccgatcggcgccagcggcgcgcgcatcctggtc
acgctgctgcacgagatggcgcggcggaaggtccggtacggtcttgccgcgctgtgcatc
ggcggcggtcagggcatcgccgccgtggtggaacggccggattga

DBGET integrated database retrieval system