KEGG   Thermobacillus composti: Theco_1703Help
Entry
Theco_1703        CDS       T02394                                 

Definition
(GenBank) 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
tco  Thermobacillus composti
Pathway
tco00010  Glycolysis / Gluconeogenesis
tco00020  Citrate cycle (TCA cycle)
tco00620  Pyruvate metabolism
tco00640  Propanoate metabolism
tco00650  Butanoate metabolism
tco00680  Methane metabolism
tco01100  Metabolic pathways
tco01120  Microbial metabolism in diverse environments
tco01130  Biosynthesis of antibiotics
tco01200  Carbon metabolism
Module
tco_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theco_1703
   00020 Citrate cycle (TCA cycle)
    Theco_1703
   00620 Pyruvate metabolism
    Theco_1703
   00640 Propanoate metabolism
    Theco_1703
   00650 Butanoate metabolism
    Theco_1703
  Energy metabolism
   00680 Methane metabolism
    Theco_1703
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Theco_1703
Enzymes [BR:tco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Theco_1703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4 Fer4_7 Fer4_10 Fer4_2 Fer4_6 Fer4_21 Fer4_16 Fer4_8 Fer4_9 Fer4_4 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AGA57835
UniProt: L0EFC0
Position
complement(1788298..1789305)
Genome map
AA seq 335 aa AA seqDB search
MAVLPKTNELGFFEIRLESIGGLGANLAGKMLAEAGVVGSGFNGVSFSSYGSEKKGSPVK
AHIRFCAPDVHIRDTTPIERPHIVGIFHENLYKTVNVISGIYEDSIVLVNSAKSPEQLKD
KLKLLGGTIAVVDATGIALEEKNRVNMAMLGGLFRLCDFLDPEFMKGVIRKSLEKKYPQA
VEPAIRTFERGYNEVKFQTFSLAEGVEMPKPTRWDIPILGYETQPIGGTVTNPGNSILKD
LSISRAGMMPHFHEDKCIHCAACDTACPDFCFVWEEKPDKKGRPQMFLQGIDYQYCKGCL
KCVVACPTEALTAERETDGYGEEHRVPHRFALANG
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggctgtattgccgaagacgaacgagcttggtttctttgagattcgcctggaatccatc
ggcggactcggcgccaatctcgccggcaagatgctggccgaagcaggcgtcgttggaagc
ggattcaacggtgtcagtttctcatcctacggctcggagaagaaaggttcgccggtcaag
gcgcatatccgtttctgcgcgcccgatgtccatatccgggacacgactccgatcgagcgg
ccgcatatcgtcggcattttccatgagaacctgtacaagacggtcaacgtcatcagcggc
atctacgaagacagcatcgtgctggtcaactcggccaagtcgcccgaacagctcaaagac
aaactgaagctgctcggcggcacgatcgcggtcgtcgacgcgacgggcatcgcgctcgaa
gagaagaaccgcgtcaacatggcgatgctgggcggactgttcagactgtgcgatttcctc
gatcccgaattcatgaaaggcgtcattcgcaagtcgctcgagaaaaagtatccgcaagcc
gttgaaccggcgatccggacgttcgagcgcggctacaacgaagtgaaattccagacgttc
agtctggccgaaggcgtcgaaatgccgaagccgacccgctgggacattccgatcctcggg
tatgaaacgcagccgatcggcggaacggtcacgaatccgggcaacagcatcctgaaggat
ctcagcatttcccgcgcgggcatgatgccgcatttccatgaggacaaatgcatccactgc
gcggcctgcgacacggcctgccccgacttctgcttcgtctgggaagagaagcccgacaag
aagggccgtccgcagatgttcctgcagggcattgactatcagtactgcaagggctgcctg
aaatgcgtcgtcgcctgcccgaccgaagcgcttacggccgagcgggagacggacggctac
ggcgaggaacaccgcgtgccgcaccgcttcgcgctcgcgaacgggtaa

DBGET integrated database retrieval system