KEGG   Thermobacillus composti: Theco_3204Help
Entry
Theco_3204        CDS       T02394                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
tco  Thermobacillus composti
Pathway
tco00230  Purine metabolism
tco00240  Pyrimidine metabolism
tco01100  Metabolic pathways
tco01110  Biosynthesis of secondary metabolites
Module
tco_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
tco_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
tco_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:tco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Theco_3204
   00240 Pyrimidine metabolism
    Theco_3204
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tco04131]
    Theco_3204
Enzymes [BR:tco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     Theco_3204
Membrane trafficking [BR:tco04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    Theco_3204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AGA59259
UniProt: L0EHY9
Position
complement(3374853..3375269)
Genome map
AA seq 138 aa AA seqDB search
MENGKRTFVMIKPDGVERGLVGEIVSRFERRGFKLAEARMMRISRETAEEHYAQHKGKPF
FGELVDYITSGPVFAMILEGEGAVQLARAMIGATNPANAAPGTIRGDYARSVEANVIHGS
DSDESAEREIRRFFGPQA
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacggcaagcggacattcgtcatgatcaagccggacggcgtggagagagggctg
gtcggcgagattgtgtcgcgcttcgaacgccgcgggtttaagctggcggaagcgcggatg
atgcgcatcagcagggagacggcggaggagcattacgcccagcacaagggcaagccgttc
ttcggagagttggtcgactatattacgtccggcccggtcttcgcgatgattctcgaaggg
gagggggccgtgcagctggcccgggcgatgatcggcgcgacgaatcctgcgaatgccgcg
cccggcacgatccgcggcgactacgcgaggtcggtcgaagcgaacgtcatccacggttcc
gattccgacgagagcgcagagcgcgagatccggcggttcttcggtccgcaggcgtga

DBGET integrated database retrieval system