KEGG   Thermobacillus composti: Theco_3306Help
Entry
Theco_3306        CDS       T02394                                 

Definition
(GenBank) beta-galactosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
tco  Thermobacillus composti
Pathway
tco00460  Cyanoamino acid metabolism
tco00500  Starch and sucrose metabolism
tco01100  Metabolic pathways
tco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Theco_3306
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Theco_3306
Enzymes [BR:tco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     Theco_3306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: AGA59357
UniProt: L0EHU9
Position
complement(3493692..3495044)
Genome map
AA seq 450 aa AA seqDB search
MTILTFPKDFVWGVSTSAYQIEGALTEDGRGPSIWDTLAAIPGRIMNGDDASVACDSYHR
YEEDIALMKELGVKAYRFSVSWPRIYPQGDGEVNPKGIAHYKRFVTKLREAGITPFCTLY
HWELPQALQDRGGWENRATIDAFVRFAETMFREFDGLIDYYMTFNEPWCIAINGHLLGRH
APGITNWQSAIQVAHNVMVAHGRTVRRFRELGVKGQIGYAPDMYWYEPLTRKQEDVDAAY
RAFSIYNWFVEPVFTGKYPEKMAEWIKSKGAEPVVEPGDMDIIREPMDFLGLNFYGGNIV
RHKPGNNYLDLEHVDLGYAKSDKGWFIYPEGLYKMLTWLTDNFGPIPIYITENGVCYNDE
PGPDGRIRDDRRIAFLRDHIAELGRAIASGVNLKGYLTWSLMDNFEWAFGYTCRFGLVHV
DYNTLKRTPKDSFYWYKKIIRNNWIELESR
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgaccattttaacgtttccgaaagatttcgtctggggcgtctcgacgtccgcctatcag
atcgagggcgcgctgaccgaggacggccgcggtccgtcgatctgggatacactggccgcc
attccggggcgcatcatgaacggcgacgacgcgagcgtcgcatgcgacagctaccaccgg
tatgaagaagacatcgcgctgatgaaagagctcggtgtgaaagcgtaccgcttctcggtg
tcctggccgcgcatctatccgcaaggggacggcgaggtgaacccgaagggcatcgcgcat
tacaagcggttcgtgacgaagctgcgcgaggcgggcatcaccccgttctgcacgctctat
cactgggaactcccgcaggcgctgcaggaccggggaggctgggaaaaccgggcgacgatc
gatgcgttcgtccgtttcgccgagacgatgttccgcgaattcgacgggctgatcgattac
tacatgacgttcaatgaaccgtggtgcatcgcgatcaacggccatctgctcggccggcac
gcgccgggcatcacgaattggcagtcggccattcaggtcgcccacaacgtcatggtcgcc
cacggccggacggtgcgccgcttccgcgagctaggcgtgaaggggcagatcggctacgcg
ccggacatgtactggtacgagccgctcacccgcaagcaggaggacgtcgacgcggcctac
cgcgcattttccatctacaactggttcgtggagccggtcttcaccggcaagtatccggag
aagatggcggaatggatcaagtcgaaaggcgccgagccggtcgtcgagccgggcgacatg
gacatcatccgcgagccgatggatttcctgggcctgaacttctacggcggcaacatcgtg
cggcacaagccgggcaacaactacctggacctcgagcatgtcgatctcggctatgccaag
tcggacaagggctggttcatttatccggaaggcctgtacaagatgctgacctggctgacg
gataatttcggcccgattccgatctacatcacggagaacggcgtctgctacaacgacgag
ccgggaccggacggccggatccgggatgaccgccgcatcgcgttcctgcgcgaccatatc
gccgagctcggccgcgcgattgcgtccggtgtcaatctgaaagggtatctgacctggtcg
ctcatggacaatttcgagtgggcgttcggctacacgtgccgcttcggcctcgtgcatgtc
gattacaacacgctgaagcgcacgcccaaggacagcttctactggtacaagaaaatcatc
cgcaacaactggattgagcttgagagccgttaa

DBGET integrated database retrieval system