KEGG   Thermobacillus composti: Theco_3436Help
Entry
Theco_3436        CDS       T02394                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
tco  Thermobacillus composti
Pathway
tco00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:tco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Theco_3436
Enzymes [BR:tco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Theco_3436
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Theco_3436
    1.1.1.-  
     Theco_3436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc Formyl_trans_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AGA59481
UniProt: L0EIG0
Position
3661159..3662217
Genome map
AA seq 352 aa AA seqDB search
MKAARWYKAKDIRVENVEEPKVTAGHVKIEVAWAGICGSDLHEYAAGPVFISANVPHPVT
GELPPITMGHEFSGTVVEVGEGVTKVKPGDKVVVEPIICCGECAACRQGKYNVCRKLGFV
GLSGRGGGFSEYVVAEERWVHKMPEGLSLEQGALVEPAAVALHAVRQSKLKAGDKAAVFG
TGPIGLLVIEALKAAGASEIYAVELSKSRAAKALELGATAVVNPAETADVPGRIHELSGG
GVDVAYETSGALPVLQQAVESTKPCEGETIIVSLWEKDPVIKPNLMVLTERSMKGIIAYR
DIFPAVLELMTRGYFPADKLVTKKIKLDDIVPEGFEALVNDKEQIKILVSPK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcgcgctggtacaaagccaaggacattcgtgtcgagaacgtcgaagaaccg
aaggtgaccgccggccatgtgaagatcgaagtggcctgggcgggcatttgcggcagcgac
ctccacgagtatgcggcgggccccgtattcatttcggccaacgtgccgcatccggttacc
ggcgaattgccgccgatcacgatgggacacgaattctccggcacggtggtcgaagtgggc
gaaggcgtgacgaaggtcaagcccggcgacaaggtggtggtggagccgatcatctgctgc
ggcgaatgcgcggcctgccggcaagggaagtacaacgtctgccggaagctcggcttcgtc
ggcctgagcggccggggcggcggcttctccgaatacgtcgtggcggaagagcgctgggtg
cacaaaatgccggaagggctgtcgctggaacaaggcgcgctggttgaacccgcggcagtc
gcgctgcatgccgttcgccagagcaagctgaaggccggagacaaggcggccgttttcggc
accggtccgatcggcctgctcgtcatcgaggcgctcaaggctgccggtgcttcggaaatc
tacgcggtggagctgtccaaatcgcgtgccgcgaaggcgctggagctcggcgcaacggcc
gtcgtcaatccggcggaaacggcggatgtgcccggcaggatccatgaactgtccggcggc
ggcgtggatgtggcttacgagacgtccggcgcgctgcccgtgctgcagcaggcggtcgaa
tcgaccaagccgtgcgagggcgagacgatcatcgtgtcgctctgggagaaggacccggtc
atcaagccgaacctgatggtgctgacggagcgcagcatgaagggcatcatcgcgtaccgc
gacattttcccggccgttctggaactgatgacgaggggctacttcccggcggacaagctc
gtgacgaagaagatcaagctcgacgacatcgttccggaaggcttcgaagcgctcgtgaac
gacaaggaacaaatcaagattctcgtatcgccgaaataa

DBGET integrated database retrieval system