KEGG   Trypanosoma cruzi: 484299.10
Entry
484299.10         CDS       T01012                                 

Definition
(RefSeq) trypanothione reductase
Organism
tcr  Trypanosoma cruzi
SSDB
Motif
Pfam: Pyr_redox_dim Pyr_redox_2 FAD_binding_2
Other DBs
NCBI-GeneID: 3531726
NCBI-ProteinID: XP_802453
GeneDB: Tc00.1047053484299.10
UniProt: Q4CL55
AA seq 189 aa
IKNGGVQVDEYSRTNVSNIYAIGDVTNRVMLTPVAINEAAALVDTVFGTNPRKTDHTRVA
SAVFSIPPIGTCGLIEEVASKRYEVVAVYLSSFTPLMHNISGSKYKTFVAKIITNHSDGT
VLGVHLLGDNAPEIIQGVGICLKLNAKISDFYNTIGVHPTSAEELCSMRTPSYYYVKGEK
MEKPSEASL
NT seq 570 nt   +upstreamnt  +downstreamnt
atcaagaacggtggtgtgcaggtggacgagtactcgcgcacgaatgtttccaacatttac
gccatcggtgacgtcacaaatcgtgtcatgttgacacccgttgccataaatgaagccgct
gcccttgtggataccgtctttggtaccaatccgcgaaagacggaccacacccgtgtggcg
agtgccgtcttctctattcctccaattggtacctgcggtctcattgaagaggttgcatcc
aagcgctacgaggtggtggcggtatacctttccagctttaccccgctcatgcacaacatc
agcggatcaaagtataagacttttgttgcaaagataattaccaaccactccgatggcact
gtgcttggtgtacatcttcttggggacaatgccccagaaatcatccaaggtgttggtatc
tgtctcaagttaaatgccaaaatatccgacttctacaacactattggtgtgcatcccaca
agtgcggaggagctgtgctccatgcgcactccttcttactactatgttaaaggtgagaag
atggaaaagccttcagaggcatctctgtaa

DBGET integrated database retrieval system