KEGG   Trypanosoma cruzi: 503521.50Help
Entry
503521.50         CDS       T01012                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase 2
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tcr  Trypanosoma cruzi
Pathway
tcr00040  Pentose and glucuronate interconversions
tcr00052  Galactose metabolism
tcr00500  Starch and sucrose metabolism
tcr00520  Amino sugar and nucleotide sugar metabolism
tcr01100  Metabolic pathways
tcr01130  Biosynthesis of antibiotics
Module
tcr_M00361  Nucleotide sugar biosynthesis, eukaryotes
tcr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    503521.50
   00052 Galactose metabolism
    503521.50
   00500 Starch and sucrose metabolism
    503521.50
   00520 Amino sugar and nucleotide sugar metabolism
    503521.50
Enzymes [BR:tcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     503521.50
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 3538934
NCBI-ProteinID: XP_808500
GeneDB: Tc00.1047053503521.50
UniProt: Q4D297
AA seq 482 aa AA seqDB search
MSSVTAGISEAASACRAKMQAAGVNEACIRTFLKQHAFISKGETGNIPESSISPVESLDS
LEDITVPADPSLLEHLVVLKLNGGLGTGMGLQTAKTLLSVKDGKTFIDFTVLQLEHLRKT
YSDHLRFMLMDSFATSSETKAHIKKYSWLFDTFDKEVELIQNRVPKICQDTLLPVTYEAD
ASCEWAPPGHGDLYTALYGSGKLDDLLRGGYKYMFVSNGDNLGATLDARLLAYMKSNQLE
FLMEVCRRTESDKKGGHIAYQTACFDDDTAPERRFILRESAQCRKEDEASFQDVEKHRFF
NTNNLWVDLAALKKTMDSHSGTLPLPVIRNAKTVNPVDGTSTKVYQLETAMGAAIGLFRR
SAAVVVPRERFAPVKTCSDLLALRSDAYVLTEDQRLVLCEERAGKPPTIELDNQHYKIIT
GLDALVKDGVPSLRQCTKLIIQGPVEFQSGTVVKGEVVIRNSKKEPFIIERDRVLNNEVM
EV
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctgtaactgcggggatctcagaggctgcttctgcctgcagggcaaagatgcag
gcggcaggggtgaacgaggcgtgcattcgcacatttttgaagcagcacgccttcatcagc
aaaggagaaacaggcaacatccccgagagcagcatatctcccgtagagtccctcgactca
cttgaagacatcaccgtgccggcggacccttctctactggagcacctggtggtactgaaa
ctcaatggcggtcttggcacgggcatgggactacagacggcgaaaactcttctttccgtc
aaggatggcaaaacattcattgattttactgtgctgcaactggaacatcttcggaagacg
tacagtgaccatctacgttttatgctgatggactcctttgccacctcttctgagacgaaa
gcccatataaaaaaatactcatggttatttgacacctttgacaaggaggtggagttgatt
cagaaccgtgtaccaaaaatttgccaggacactcttcttcccgttacgtatgaggcagat
gcctcgtgcgagtgggcgcctccgggacatggggacctttacacggcactctatggtagc
ggtaagctggatgatctgcttcgcggtgggtataaatatatgtttgtatccaacggtgac
aacttgggggcaacgctggatgcccgtcttctcgcatatatgaaatcaaaccagttggaa
ttccttatggaggtttgcaggcggactgaatctgataaaaagggtggtcatattgcctat
caaactgcttgttttgacgatgacacagcgcccgagcgtcggtttatactacgtgagtcg
gcgcagtgtcgaaaggaagatgaggcgagttttcaggacgttgagaagcatcgttttttt
aacacgaacaatttgtgggtggatcttgcggctctcaagaagacgatggacagccacagc
gggacactgccactgcctgtgattcgaaacgcaaaaacagtgaacccggtagatggcacc
tcaacaaaagtgtatcaactggagacggcaatgggcgcggccattgggctctttaggcgc
tctgcagcagtggtagttccacgagagcgttttgcccctgtaaagacttgctcggattta
cttgcgctacgatccgatgcgtatgtcttgacggaagatcagcgtcttgttctctgtgag
gagcgggccggaaagccaccgacgattgaacttgataaccaacactataagatcatcact
ggtctggatgcgctggtgaaggatggtgtgccatcgctacgacaatgcactaaactcatc
attcagggcccagtggagttccagagtggcacagtggtgaagggtgaggtggtgatacgc
aacagtaagaaggagcctttcattattgaacgcgaccgagtgctgaataatgaagtgatg
gaggtttag

DBGET integrated database retrieval system