KEGG   Trypanosoma cruzi: 503935.20Help
Entry
503935.20         CDS       T01012                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tcr  Trypanosoma cruzi
Pathway
tcr00020  Citrate cycle (TCA cycle)
tcr00310  Lysine degradation
tcr01100  Metabolic pathways
tcr01110  Biosynthesis of secondary metabolites
tcr01130  Biosynthesis of antibiotics
tcr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    503935.20
  Amino acid metabolism
   00310 Lysine degradation
    503935.20
Enzymes [BR:tcr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     503935.20
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H HlyD_3 HlyD_D23 RnfC_N CCDC53
Motif
Other DBs
NCBI-GeneID: 3532997
NCBI-ProteinID: XP_803343
GeneDB: Tc00.1047053503935.20
UniProt: Q4CNP4
AA seq 392 aa AA seqDB search
MLRRFSALGLQPRRWGLQKLSARFCLSINVPTIAESISSGKVVGWTKKVGDAVSEDEVIC
QIESDKLNVDVRAPTNGVITKINFEEGAVVEVGAELSTMKAGEAGGAAAAPAMQPPPPPP
PQQQQQSSPPPPQQKRSVETPAPAPKPPQVVTTATTGSDPRVRNVRISSMRHRIADRLKA
SQNTCAMLTTFNEIDMTPLIEIRNRYKDDFYKKHNVKLGFMSPFVKACAIALQDVPAVNA
SFGTDFIEYHDFVDISIAVSTPRGLVVPVLRDVQKADFAQIERQIADFGARARVNKLTLA
EMTGGTFTISNGGVFGSWMGTPIINPPQSAILGMHATKKKPWVVGNEIKIRDIMAVALTY
DHRLIDGSDAVTFLVKVKNLIEDPARMVLDLA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgtcgcttcagtgctttggggctgcagccccgccggtggggcctgcaaaagctt
tcggctcgcttctgcctcagcattaacgtgccgaccattgcggagtcgatcagctccggc
aaggttgtagggtggaccaagaaagttggcgacgccgtcagcgaggacgaggtgatctgc
cagatcgagtcggacaaactcaacgtcgatgtgcgggcgccgacaaacggcgtcatcacg
aagatcaactttgaagagggggccgtcgtcgaggtgggcgcggagttgtcaacgatgaag
gcaggggaggctggcggagcggcagcggcccccgcgatgcagccaccaccaccaccacca
ccgcagcagcagcagcagtcatcaccaccaccgccgcaacaaaaacggtctgtagaaacc
ccagcaccggcgccaaaacctccgcaagttgtgaccacagcgaccaccggctccgaccca
cgtgtgcgaaatgtgcgcatctcttccatgcgccatcgtatagcggatcgtctgaaggcg
agccagaatacgtgtgcgatgctgacgactttcaacgaaattgatatgactcccctcatt
gagatacgtaaccggtacaaggacgacttttacaagaagcacaatgtaaagctgggattt
atgtcaccttttgtaaaggcctgtgccattgcactgcaggatgtacccgcagtcaatgcc
tcctttggtacggactttattgagtaccacgattttgttgatatcagcattgcggtatca
acaccacgaggacttgttgttcccgttctgcgtgatgtacagaaggccgattttgctcag
attgaaaggcaaattgccgactttggggcgcgggcaagggtaaataagctgacgctggct
gagatgacgggcggtacattcaccatcagtaatggcggcgtttttggctcgtggatgggg
accccaatcatcaacccaccgcagagtgccattctcggcatgcacgcaacgaagaagaag
ccatgggtggtggggaacgagattaaaatacgcgacattatggcggtagcactgacgtac
gaccatcgcctcattgacggcagcgacgcggtgacatttcttgtgaaggtgaagaacctc
attgaggaccccgcccgcatggtgcttgacctcgcgtag

DBGET integrated database retrieval system