KEGG   Trypanosoma cruzi: 506435.20Help
Entry
506435.20         CDS       T01012                                 

Definition
(RefSeq) hypothetical protein
Organism
tcr  Trypanosoma cruzi
SSDB OrthologParalogGFIT
Motif
Pfam: Piezo_RRas_bdg
Motif
Other DBs
NCBI-GeneID: 3553849
NCBI-ProteinID: XP_820998
GeneDB: Tc00.1047053506435.20
UniProt: Q4E330
AA seq 2724 aa AA seqDB search
MPWSHGLSRPFTPHLQCVILSIVYLHSLFIPALLGQSIIATLLLVLNLVCAVRYENHRWR
HLTLHSSDNWNDAISARLIPVRKVSLLSFLLPSQLLLYVSLVFSCLQLFLAATLGWLLGL
SFMQQGWPKAVLNSLGVWGRKDVLPLVVNVVSSTLLAVSSASLCFLLRKHQFQPSTEPNR
LFHRSSLLCLALLAPVTASLYPTYDCTPLFVVHFLCIMSFSISSFPVLRVRLLEVATKGC
TVVSLLLLAGGLLAQSPVVQQIVLEHGEPIDAWSIMRYECDWAKIFKSSAVFRRGAQFLL
LSYTIVASRYVHGSWRRISRRELEEHREYFYEPPFLLWQLFSVRYPARLRKIQQFMGYYL
PLAVFPLMIIMSFMVMDLVSILMVITTLFGFLLPSDTYVVLLPFCYGAIALGIVLEFVAT
VDSRLQQPFFMVYAATGVTAFMIRLAQCFVNSLLILAVCMFRVNPIQGQYRSLAEKKAQI
RMAFNHLQNRLDEIQCIFKRVCNGTTGTVNRDGFPELLKQVLPTSRIREKEIDSLWRFLT
EGEPVLLQTTPQVTPRINKATLEFAGNADAVRNPLSHLSSALHGGRRASTSREESNGNRD
DNDEKGEDMDLEAWKEIKNGLDSSSCMGALEIKSPSREEEKSLEAASTTISFWDVSSGED
QFRRGEHKNGLEDKVQHQQCSGRNSDALSRTISAVGSPGGTVAYLDFLVLVSKIESYRMQ
HRNGVYVAASMLKQIICLNTSTLSLVAMFAISMAVKRLDILNGMYLLFFIGLACVPWYML
YCWFIIVAYTALHVAVRFTVMVYNASYHPNDTPSYWMEIIGIDIGKDPFALLVYFLLLIL
AVFQLRISRHEASGKITIQEILQRMEWCRYTSCDFFPQFYRHFLELSTSLVLVMMALFIP
HNVFIAGFALLFLLYFSLGAYSKLAESVTLIALGAYNVAVLLISALYHVPAISNSFAERL
SNITVCQKITVERCALDVGVSQNNQFGSMSLNLLPWYLAAALSVALCRHYFGVLGRGINR
REEGNDDEGASVRMEEMQNMPDPSISNRRGAREEEEEEVARERNHAMRGERDFLENDGRQ
RMGLFFCSYTATRGTFIGRCVPMAFAISRYLYLVVTFIREAGTAQGKLMVWVSLAYASLS
NFSVLGAAFMTLFLLDSRGMPVVAVAVAQMALNYVYPFFFIPEAPLSVSSKRFFGLQKTQ
NGERPSILPPILACAMAVFYMHTEKDRTARHQEDALRQAHRRNNPPYHNPSARDGMRAFV
RSEEIQTPYVPFVASRENRERTREVYEPPAKFVTLKQHLIFMWNYFRTRFFLDLNFELTV
LVASLGLALTPDRVTGLVFFVELLLMWLIGRVRSTIEIRYAVLQESLIVIVLGGLYFIRL
GLPKGLVGVSILHPEECNAWDHYCGCGLPLHHFVLMFALVVMRRCMRQNVAKVRATILCV
EGAFELGELLRRKEKEVEDCRRLLRSDIESVLPAPSRDIIRNPRTLFDLLIAVSCACLPA
AVFAFVQGVLMASLLGVVEIAASLWILAFKRYLAWRWHKVWPFFILFLFLTFVPQLVARL
PLSPPLTTHAENLMLALGFSPWTRGTTVGQAMVLFSAVVQQRIFSEFFFAAYLIGLCRGS
LAAVERNREMLEYFRRKDEELQCQVVKEEEALKRRLEQLFSERNMCACQDEIEIGALMPP
QRVNEKETREEREFSSGVAPHSPMMGSVSKVPLSVSAQSDTYFSVLDSPKQLTKAGAAVD
CPAATFDGRLSGVCSEEHVPPAREDDRKGGICSKISNAIECWSEQLVQYFTFRTYRGKAP
PRTYSQGYRVLFAFTQFLLRKYAYVCYFLFMLNYALSGTIVDMVLSLSAALYGMLILPWS
GKIYWRNALIYNVFSILVKCVIQLIVKWFAMNQMALKIVSACVLDIGLDRTEPSFSAMNL
DIIMDFVLFVSIIIHRQFCFDYGVFAKEHEEPFIPHRMETEKGEVHRKEKHHRNEESTAG
RRELPEEDMDRIDVQCVVGVANEGRPSRQEPLSASSSSSSSSTLELLANKHDDNNVTNSK
HDGIGEYNNSMRQKWQKRVFKKGGVLQKYWSNICERYGTGSDYYTLQFWADGLSLIVFTV
VYFLLAGDFRGSILYSVQQDLLPWQLVLILFAGVILMAAERIVYVLHSVQLKFVLHVVTI
LAYHAIFMLWRLTLAHRSTTVAVIILLMRFFSGSVSALQLQKGYPLHRKHDPFTTHTDIF
HWLGHVVYRAIPFLFELRLLLDWSVSCTALKLQDWMLLEDVHHTVYMRYVDINDLAWTSP
RKGRQFPFFVRMYQGIVGFAACLLVLFFPLMLYSTFNPNVGVNLVASWQTKIAFGTTSNF
YTATATEVSVSQNLVSILWDLLPSLQHDEFGSQGLLQLLMFPRCSAEVWSATPETRLLLL
SQLNAAVNNETTFFIHKEDHVVRMEVSAPATRRVCSYQRYMVPWSTVVRLRDALEGAHLW
YTSRHLEKHQGGVHSASTLVYESGDWIPLPQFYSPFVNNIQNDLVMKNYVRTDCAVQLNG
VGNSDGKTPPVLYWCVRCNSFANLTDGSTTRTWSMNGANEPLDMADSDNDNVEVMQSKET
LESGTDAGNITSIFEIVASSYVALNPSLVFLPNMGIIALYTTFILAIGTFLRNTVMDRAH
RVVLMQVANPDPIAELLRYIYMARSSAINGYVDGLLLEQQLFFELVDMLRSPERVLALSG
RRVDDYDNCGRFCKYLKKSSYHPF
NT seq 8175 nt NT seq  +upstreamnt  +downstreamnt
atgccttggagtcatgggttgtcacggccatttacgccgcaccttcagtgtgttattctc
tctatcgtttatttacactctctttttataccagcgctcttgggccaaagcataattgcg
actcttcttctcgttttaaatcttgtttgtgccgtgcggtacgagaaccatcggtggcgg
catctcacattacacagcagtgacaattggaatgacgccatttcggcacgacttatacca
gtaagaaaagtgtcactgctttcatttcttcttccttctcaactgctgttgtacgtgagt
ctggttttctcctgcctacagttgtttcttgccgccacccttggttggttgcttggtcta
tcattcatgcagcaggggtggccaaaggcggtgttgaatagccttggagtgtggggaaga
aaggacgtccttcccctcgtggtcaatgtcgtgtcatcgacgcttttagcagtctcaagt
gcatcgctttgttttctactccgcaagcatcaatttcaaccttcaacggagccaaaccgt
ttgtttcatcgtagttctctgctgtgccttgccttgctcgcaccagtgaccgcctcttta
tatcccacttacgactgcacgcctctgttcgttgttcatttcttgtgtattatgtctttt
tcgatctcttcattcccagttctacgggttcgattattggaggtggccacgaaagggtgt
acggtggtgagtcttctactgctcgcggggggactgttggcgcagtcaccagttgtgcag
caaattgttcttgagcacggggaacctattgatgcctggagtatcatgcggtatgaatgt
gattgggccaagatatttaaaagtagtgcggtctttcgaaggggcgcacaatttttgctc
ctgtcgtacaccattgtggcctcacgttatgtgcatggtagttggcgccgcatatcaaga
cgtgagttggaggagcacagggaatatttttatgagcctccatttttactatggcaactc
ttctctgtgcgatacccagcaaggttgaggaaaatacagcagtttatgggatattactta
ccgctagccgtttttcccctgatgatcattatgagttttatggtcatggatcttgtctct
attctgatggttattacaaccctctttgggtttttgttgccgtctgacacgtatgtggtg
ctgcttccattctgttacggagcaattgcattggggatcgtcttggagtttgtggccact
gtagacagccggttgcaacagccgttctttatggtttacgcagcaactggtgtgaccgcc
tttatgatacgcctcgctcagtgctttgtaaactctttgcttatcctggctgtgtgcatg
tttcgtgtgaaccccattcagggacaatatagatcgctcgcagagaaaaaggcacaaatt
cgaatggcatttaatcacctccagaatcgccttgatgaaatacaatgtatttttaaacgg
gtatgcaatggcaccacaggcactgtgaaccgtgatggatttcctgagcttttaaagcag
gtgttaccgacatcccgcattagggagaaggaaatagactcactttggcgttttttgacg
gaaggggagccggttcttctgcaaacaaccccacaagtaaccccaagaataaataaggcc
accctggaatttgcagggaatgccgatgcggtaagaaatcctttgagccatttgtccagt
gctcttcatggcggccgaagagcgtccacatcgcgcgaggagtcaaacggcaaccgcgat
gacaatgatgaaaaaggagaagatatggatttagaggcatggaaggaaattaaaaacggc
cttgattccagttcctgcatgggcgctttggagataaagagcccttccagggaagaggaa
aagtcgctagaggctgcgtccacaacgatctctttctgggacgtttcgtcgggagaagac
caatttcgccgtggtgagcataaaaatggtctggaggacaaagtgcaacatcaacagtgt
tcggggcggaactcagatgcgctttcgcgtaccatttctgccgttgggtcgcctggtggt
accgtcgcctatcttgactttcttgtgctagtgagtaagattgagtcgtatcgtatgcaa
catagaaacggggtgtatgtggcggcgtcaatgctaaaacaaatcatttgccttaatacc
tctactctttctcttgttgcgatgtttgccatttccatggccgtaaaaaggttggatatt
cttaatggtatgtaccttttgttttttattggcctggcatgcgtcccatggtatatgttg
tactgttggtttatcatagttgcgtatacagcgttgcatgtcgcagttcgatttactgtc
atggtctacaatgccagctatcacccaaatgatacaccttcgtactggatggaaattatt
ggcattgatattggcaaggatccttttgcccttttggtttactttcttttacttatcttg
gcggtgtttcaacttcggatttcaaggcatgaggcgagcgggaagattaccatccaagaa
attcttcagcggatggaatggtgtcgttatacgtcgtgtgatttttttccacagttttac
cgacatttcttggaattgtcgacgtcgctggtgttagtgatgatggcgctttttattcct
cacaacgtttttatcgccggctttgcgctcctgtttcttctctatttctccttgggagcg
tattccaagcttgccgagagtgtgacgctgatcgctttaggtgcatataacgtggcggtg
ttgcttatcagtgcactttatcatgtaccagccatttcaaattcttttgctgaacgattg
tctaacattaccgtgtgccagaaaatcacggtagagaggtgtgcgttggatgttggtgtc
tctcagaataatcagtttggttccatgtcgttgaaccttcttccatggtacttggcagca
gcactgtctgttgccctttgcaggcattattttggggtgcttgggcgtgggataaataga
cgtgaggagggaaatgacgacgaaggagcctcagtaagaatggaagagatgcaaaacatg
cctgatccttcgatttcaaaccgtcgcggagcacgtgaggaagaagaagaagaagtggcg
agggaaagaaatcatgcgatgcgtggggaaagagattttcttgaaaacgacgggaggcaa
cggatggggttgttcttctgctcttacacagcaacacgtggtacatttatcgggcgctgt
gtaccaatggcgtttgcgatatcacggtatctttaccttgtcgtcaccttcattcgagaa
gctgggacagcacagggcaagctgatggtgtgggtatctctcgcgtatgcaagtttatcc
aacttctccgtcttgggggcggccttcatgacactttttcttctcgactctcgcggcatg
ccggtggtggctgttgctgttgcgcaaatggcattgaactatgtgtacccgtttttcttc
atcccggaggctccgctttcagtcagcagtaaacgttttttcggcctgcaaaaaacgcaa
aacggggagaggccgagtatcctgccgccaattctggcatgcgccatggcagtattttac
atgcacacggagaaggaccggaccgcacggcatcaagaagatgcactgcgtcaagcacat
aggcgtaataatccaccttatcataatccttcggcacgcgatggaatgcgggcatttgtc
agaagcgaggagattcaaacgccatatgtaccgtttgtggcatcgcgggaaaatcgagag
aggacgcgtgaagtgtacgagcctccggctaagtttgttactctcaaacagcacctcatt
ttcatgtggaactacttccgaactcgtttttttctggatctcaactttgaactcacagtg
ctcgttgcgagtctcggtcttgcccttacgccggatcgtgttacggggcttgtctttttt
gttgagcttcttctaatgtggttgattggacgtgtgcgaagtacaatagagatacgctac
gccgtgctccaagagtccctcattgtgattgttctcggcggattatactttattcgtcta
ggactgccgaaggggctggtgggcgtctccatcctacacccagaggagtgcaatgcatgg
gaccattattgtggctgcggccttccgctgcatcactttgtcctcatgtttgcacttgtg
gtgatgcggcgctgcatgcggcaaaatgtggccaaggtacgcgcaacgattttgtgtgtg
gagggtgcttttgagctcggtgagcttctccgcaggaaggaaaaagaagtggaggactgt
cgaaggctcctccgctcagatattgaaagcgttctacctgctccatcgcgcgatattata
cggaacccaaggacgctgtttgatctccttatcgccgtgtcgtgtgcatgtttaccagct
gcagtatttgcctttgtacagggcgtcttgatggcgtcactgctgggggtcgtagaaatt
gcggcatccctctggatcctggcattcaagcgttatctcgcgtggcgttggcataaagtt
tggccgtttttcatattgtttctttttttgacttttgtccctcagttggtggctcgtctt
ccgctgtcacctccgctaacgacccacgcggagaatttgatgcttgcgctcggctttagt
ccctggacacgtgggaccacggtgggacaggcgatggtgctcttttcggctgtggtgcag
caacgcatctttagtgagtttttctttgcggcatatcttattgggctatgcaggggctca
ctggccgctgtagagcggaatagggaaatgctggaatatttccgtaggaaagacgaggag
ctgcagtgtcaagtagtcaaggaggaggaagcattgaaaagaaggctcgaacagcttttc
tccgagcggaacatgtgtgcgtgccaagatgaaatcgaaattggggctttgatgccaccg
cagagagtgaacgagaaggaaacgagggaggaaagggaattctcaagtggagtggcaccg
cattctcctatgatgggttcggtttcgaaggttccgttgagtgtttctgcgcagtcggac
acttatttcagtgtcttggattccccaaagcaactgacgaaagcaggggcggccgttgac
tgccctgccgcaacgtttgacgggaggttgagtggcgtttgctcagaagaacatgtcccc
cctgcacgggaagacgacaggaaaggagggatatgcagtaaaatatcgaatgcgattgaa
tgttggtcggagcaacttgtgcaatattttaccttccgcacttatcgtggaaaggcgcct
ccacggacgtattctcaggggtaccgtgtactctttgcatttacgcaatttcttttgcgg
aaatatgcctatgtgtgctatttcctatttatgcttaactatgcgcttagcggaactata
gtggatatggttctctccctctccgccgcactctacgggatgcttattttgccatggtca
gggaaaatttactggagaaacgctcttatttacaatgttttctccattcttgtcaagtgt
gtcatacaacttatcgttaaatggtttgccatgaatcaaatggcattgaaaattgtttct
gcgtgtgtgctggacattggcctggaccggaccgaaccgtccttttctgccatgaatttg
gacattattatggactttgttctctttgtcagcatcattatacatcgtcagttttgtttt
gattacggcgtttttgctaaggagcacgaggagccattcataccgcatcggatggaaacg
gaaaagggggaagtccacagaaaagaaaaacatcaccgcaacgaggagagcacggcgggc
cgacgtgaattgcccgaggaggatatggatagaattgatgttcagtgtgttgtgggtgtt
gcaaatgaaggaagaccgtcacggcaggaaccattgtcagcatcatcatcatcatcatca
tcatccactctggagttgctggcgaataagcatgacgataataacgtcactaatagcaaa
catgatggaattggtgagtacaacaactcaatgcgtcaaaaatggcaaaagagagtcttc
aaaaaaggtggagtgttgcaaaaatactggagcaacatatgtgaacgctatggtactgga
tcagactactacacccttcagttctgggcggacggtctctctcttatcgtctttaccgtg
gtttactttcttttggcgggtgatttccgcggcagtattctttacagcgtacagcaagat
cttcttccctggcaattggtactcattctctttgcaggggtcattttaatggcggctgag
cgtatcgtatatgtgttacattccgtccagctcaagtttgtccttcatgtagttacgata
ttggcgtaccatgctatcttcatgctgtggcgcctcacactcgcccatcggtcgaccacg
gttgctgtcattattcttttgatgaggtttttttctgggagtgtgagtgcattacaattg
cagaaggggtatccgcttcaccgaaagcatgatcctttcacgacacacacggacattttt
cattggctaggacatgttgtgtatcgcgccataccatttctttttgagctgcggctttta
cttgactggtcggtctcttgcacggcgctaaagttgcaggattggatgcttcttgaagat
gtgcatcacaccgtgtacatgcgctacgtggatatcaatgacttggcgtggacaagccca
aggaagggacggcaatttcccttctttgtgagaatgtaccaaggaattgtcggttttgcc
gcatgccttctcgtcctgttttttcctctcatgttatactccacctttaacccaaacgtc
ggtgtaaatcttgtggcgtcatggcagacaaaaattgcctttggcactacatcaaacttt
tacacagccacagccaccgaggtttccgtctcacaaaatttggtttccattctctgggac
ctgttgccatccctgcagcacgatgaatttggctctcagggcttactgcagttgctaatg
tttccaaggtgcagtgcggaggtgtggagcgccacgccagaaacacggctgttgctgtta
agtcaacttaacgcggccgtgaataatgaaacaactttttttatacataaagaggatcat
gttgtgcgcatggaagtgtcagcaccagcgacacgaagggtttgtagctatcagcgatac
atggttccttggagcaccgtggtgaggctacgggatgctctggagggggcgcatctttgg
tatacatctcggcatttggaaaaacatcagggaggagttcactctgcttccacgctggtg
tacgaaagtggcgattggattccgctaccacagttttatagtccttttgtgaataacata
caaaacgatttggtaatgaaaaactacgtgcggacagattgtgcggttcagctgaatggc
gttggaaacagtgatggcaagactcccccggtattgtattggtgtgttcgttgtaactcc
tttgctaatctgaccgacggctcaaccaccaggacatggagtatgaatggcgcgaatgaa
cctctggacatggccgatagtgataatgataatgtggaagtaatgcaaagtaaggagacg
ctggagtcgggcaccgatgcgggcaatattaccagtatttttgagattgtggcctcatca
tatgttgcactcaatccctcccttgtttttttgccgaacatgggaatcattgcactatac
acaacgttcattttggcgattgggacctttttacgtaacaccgtcatggaccgcgcacat
cgtgtggtgttgatgcaagtggcaaacccggaccccattgccgagttgcttcggtatatt
tacatggcacgttcctcagcaattaatgggtacgtggacggtcttttactggagcagcaa
cttttttttgaacttgtagatatgcttcgctcacccgagcgtgtcttggctctcagtggc
cgccgcgtggatgactacgacaactgtggcaggttttgtaagtacctgaagaagtcgagt
taccacccgttttga

DBGET integrated database retrieval system