KEGG   Trypanosoma cruzi: 507297.20Help
Entry
507297.20         CDS       T01012                                 

Definition
(RefSeq) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
tcr  Trypanosoma cruzi
Pathway
tcr00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tcr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    507297.20
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tcr01007]
    507297.20
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tcr03016]
    507297.20
Enzymes [BR:tcr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     507297.20
Amino acid related enzymes [BR:tcr01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   507297.20
Transfer RNA biogenesis [BR:tcr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    507297.20
 Prokaryotic Type
    507297.20
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1
Motif
Other DBs
NCBI-GeneID: 3533612
NCBI-ProteinID: XP_804237
GeneDB: Tc00.1047053507297.20
UniProt: Q4CQ34
AA seq 785 aa AA seqDB search
MSTSRHQPQVVGGLKVTEPVRRPRHPPWYPPVQNDAKGLRVLNSLTESVEPFAPREGRLV
RWYACGPTVYELSHMGHARAYLTFDILRRIMEDYFGYQVVYQMNITDIDDKIIKRARISA
LLKRFREDFLQGRDMARLVAFTAEAETAAVEALELARIKFSEPLPDTTPSRIKAEREEKQ
MELALKESQLQKTRERIASATASGNFDELFNAASGINGDLLDEREGQYVTDQSIFEDHAR
LYERLFFEDMRRLGVRDPDVVSRVTEYVPQVVDFIQKIMDNGFAYRGTSSIFFDTAAFLR
AGHDYPKLKPVSERGENDATEAEMAEGEGALTVGVAGEKRNANDFALWKFSKPGEPRWPS
PWGAGRPGWHIECSVMASDILGTNIDVHSGGWDLKFPHHDNECAQSEACHMQHQWINYFL
HCGHLHIKGLKMSKSLKNFITIRQALDELDVTPRVMRLLFLANHWGKPMNFSDQSIEEAK
ERERVLRAFFGSVDIVLRKDNWGKTQGLNDHDRRLQETWLTAENAVHGALQNNFDTPAAM
DSVMGLVGATNHYLLSGERPSATLVRKVGRYVTRILQVFGVVEGTDMVGFATQQGSDDRL
LTVMDALLRFRDGVRDAAKVENSTETFLPLCDAVRDEWLVPAGIRIEDNPAGPTTWKSDD
VAVLQREVAERRAQQATERRTRLENQIETKRKLTEKWRQYTCTPIRYFSTRDTEEKKYAA
FDEATGLPTRRATGEALGEKEQKKLAKELARYAKVHEEFVAKGGEGWLAEQEKELASLCQ
ALESL
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccagcaggcatcagccgcaggttgtggggggactgaaggtcacagaacccgtg
cggcggccgcggcatccgccgtggtatccgccagtgcagaatgacgcgaagggccttcga
gtgctgaactcgttgacggagagcgtcgagccgtttgccccacgtgaggggaggctggtg
cggtggtacgcgtgcgggcctactgtctatgagctttctcacatgggccatgcccgcgcc
tacctcacctttgatatactgcgtcgtatcatggaggactactttgggtatcaggttgtg
tatcagatgaacattaccgatattgacgataaaattatcaagcgagcacgtatttcggca
ttgttaaagcgatttcgtgaagatttcttgcagggacgtgacatggcgcggcttgtcgcc
tttacggccgaagcggaaacggcggcagttgaggcactcgagttggcccgaattaagttt
tcagaaccgctgccggacacaacaccaagtcgcattaaggcggagcgtgaggagaagcag
atggaacttgcgctaaaggagtcccagttgcagaagacaagggaacgtattgcatcggcg
actgcctctggtaactttgatgaactttttaacgcggcttctgggataaacggtgatttg
ctggatgagcgcgagggacagtatgtgacggaccaaagcattttcgaggatcacgcgcga
ttgtatgaacgtcttttttttgaggacatgcgacgtctcggcgtccgcgaccccgacgtt
gtctcacgtgtgacagagtatgtaccacaggtggttgacttcattcagaagatcatggac
aacggttttgcataccgtggaacgagttccatattttttgacaccgccgcctttttgcgt
gccgggcacgactacccgaaactgaagcccgtgagtgaacgtggtgagaacgatgcgacg
gaggcggagatggcggagggggagggtgcgttgactgtgggagttgccggtgagaaacga
aacgccaatgattttgccttgtggaagttctcgaagcctggtgagccgcgttggccgtcg
ccgtggggagcgggacgccctggatggcacattgagtgctccgtcatggcttcggacata
ctcggcaccaacatcgatgtgcacagcggcggttgggatctgaaattcccccaccacgac
aacgagtgtgcgcagagtgaggcatgtcacatgcaacaccagtggataaattacttccta
cactgtgggcacttacatattaagggtctcaaaatgagcaaaagcctgaagaacttcatt
accattcggcaagcacttgatgaactcgatgtaacaccacgtgtaatgcgactgttgttt
cttgcaaatcactgggggaaaccgatgaatttttcggatcagagcattgaagaggcaaaa
gagagggaacgtgtcctacgtgcgttctttggcagtgtcgatattgtcttacggaaggac
aactggggcaagacgcagggcttgaacgaccacgaccgccgtctacaagaaacctggtta
acggccgaaaacgccgtacatggcgcactgcagaataattttgacactcccgccgccatg
gattccgtcatggggctcgtgggcgcgacaaatcattacctccttagcggggaacgtccg
agcgcgacgctcgtgcggaaggttggccgctatgtcacacgcattttgcaggtgtttggt
gtggtggaagggaccgacatggttggctttgccacgcagcagggctcagacgatcggctt
ctaacggtcatggacgctctcttgcgcttccgcgacggcgtgcgtgacgcggcaaaggtg
gaaaattccaccgagacgttcctaccgctctgtgacgcagtccgcgacgagtggctggtg
cctgcgggcattcgcattgaggacaaccctgctggtccaacgacgtggaagagtgacgat
gtggccgtgctccaacgcgaggtggcagagcgacgggcgcagcaagcaacggagcggcgc
acaaggcttgagaatcagattgagacgaaacggaaattgacggagaagtggcgccagtac
acgtgcacgccgataaggtactttagcacgcgagacacagaggaaaaaaagtacgccgcc
tttgatgaagccacggggctcccgacgcgacgcgcgacaggcgaggcgttgggcgagaag
gagcagaagaaactcgcaaaggagcttgcgaggtacgcgaaggtccacgaggagtttgtt
gcgaaagggggcgaggggtggctggcggagcaggagaaggaattggcatcgctttgccag
gccctcgaaagcctctga

DBGET integrated database retrieval system