KEGG   Trypanosoma cruzi: 507611.370Help
Entry
507611.370        CDS       T01012                                 

Definition
(RefSeq) protein disulfide isomerase
  KO
K01829  protein disulfide-isomerase [EC:5.3.4.1]
Organism
tcr  Trypanosoma cruzi
Brite
Enzymes [BR:tcr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     507611.370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 AhpC-TSA Thioredoxin_7 OST3_OST6 Thioredoxin_8 TraF Redoxin Thioredoxin_9 HyaE Thioredoxin_3 DUF2987
Motif
Other DBs
NCBI-GeneID: 3554021
NCBI-ProteinID: XP_821173
GeneDB: Tc00.1047053507611.370
UniProt: Q4E3F7
AA seq 481 aa AA seqDB search
MIHFIFFVALFFCSLRAEGSEVVEATDKDFDDVISSGEIALVKFYAPWCGHCQKLAPEWE
KAAKEIPSGAVMVDVDCTKESNLAQKYSIKGFPTIILFRDGKEVEHYKGGRKSSDIVNYV
KANLGTAVVHVETAEELEKLREEHNAVCVGVTSDMESTLSKTLATSAEGLRMKMKFVVIT
DSNILPDEKPESIIVFRKGGEKEVFDGAMETADLKSFLEVAFIPFMGEINPNTYLDYAGI
SGPVAWVLLKPSEEESKELKSKLLDVGKKMRRLMVLLWVDAEQYGVASSLGLSDDAKYPA
FVIARGEDHFVHPSTEPVTAESIEKFIIEYSEKKLSPEIKSQPVPEIETVEGLTTVVGKT
LDKYLSSGKDMLIEFFAPWCGHCKNLAPIYAKVAKEFESSDVIIAAMDATANQMDNSLFD
VSGFPTIYFVPHGGKPIMYDGGRTFYEIYKFVHEHSSTLKDVPIPEEVKREEEKNGDDDD
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgatacatttcattttttttgttgccctttttttttgctcgcttcgggcggagggaagt
gaggttgtggaagccaccgataaagattttgacgacgtcatttcaagtggtgagattgcg
cttgtgaagttctatgctccatggtgcgggcactgtcagaaacttgcgccggagtgggag
aaggcggccaaagagattcctagcggggcggtcatggtggatgtcgattgcaccaaggaa
agcaatttggcccagaagtactccattaaagggttccccacaattattctctttcgtgac
ggcaaggaggtggaacattacaaaggtggtcgcaaaagtagtgatattgtaaactacgtg
aaggcaaaccttggaactgcagttgtccatgttgagactgctgaagaattggaaaaatta
agggaagagcataatgctgtatgtgtgggagtgacctcggacatggaatccacactctcg
aaaacgctagcgacttctgcagagggcctacggatgaaaatgaagtttgtggttattaca
gattcaaatattcttcccgatgagaaaccagaatccattattgttttcagaaagggtggg
gaaaaggaggtctttgatggggcaatggaaacagcggatctaaaatcttttcttgaggtt
gcttttatcccatttatgggggagatcaaccccaacacttacttggattacgctggaata
tcagggccggtggcatgggttctattgaaaccgagcgaggaggaatcgaaggagctgaaa
tccaagcttctggatgtgggaaagaaaatgcgccgtcttatggtgctcctttgggtagat
gcggaacagtatggggtggcttctagtcttggtttatcagatgatgcaaaataccctgct
tttgtgattgctcgaggtgaggaccactttgttcatccatctacggaaccggtaactgca
gagagcattgaaaaatttattatcgaatactccgaaaagaaattatctccagaaattaaa
tctcagcccgtccctgaaattgaaaccgttgaggggctgaccacagttgtagggaagaca
ttggacaagtacctttcatctggaaaagacatgttgatcgagttttttgctccgtggtgt
gggcactgcaagaatttggctccaatttacgcgaaggtggcgaaggaatttgagtcctcg
gacgttattattgccgccatggacgctactgctaaccagatggacaactctctctttgac
gtttctggttttccgaccatatactttgttccccatggaggaaagccaattatgtatgat
gggggccgtacgttctatgagatttacaagttcgttcatgagcacagctcaactttaaaa
gatgtgccgatcccagaagaagtcaagagggaagaagaaaaaaatggggatgacgatgat
ctatag

DBGET integrated database retrieval system