KEGG   Trypanosoma cruzi: 507923.30Help
Entry
507923.30         CDS       T01012                                 

Definition
(RefSeq) vacuolar assembly protein vps41
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
tcr  Trypanosoma cruzi
Brite
KEGG Orthology (KO) [BR:tcr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tcr04131]
    507923.30
Membrane trafficking [BR:tcr04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    507923.30
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Vps39_2 LysM zf-RING_11 zf-ANAPC11 zf-rbx1 zf-RING_UBOX zf-RING_2
Motif
Other DBs
NCBI-GeneID: 3535439
NCBI-ProteinID: XP_805641
GeneDB: Tc00.1047053507923.30
UniProt: Q4CU37
AA seq 1084 aa AA seqDB search
MDLHDPSEEINQQSEGEDDKGYEEVIEEMEVEEESYISGSYEEAYDEEMTDDEEEEEQKE
DQENLLSFSTFPLEALRGQHIMVAVAFNRFIVIGTNRGVVALVEGSGVVLRMLNNHIDPI
SDVSCDIMEEHVGSSDKAGVVTVQNLSDEQDFYRREFDVPIYSMALHPKYSRSEDRAILL
GGGDKVMLITKTRILGHRKITILQERRGKVYAVRWCGPELIAWANDRGVQLYSYTGRAMV
HFVSRPVDSSRLEFYRCSLVWEAPRTLTCGWGDWVQVLHVYELRMEERLRWGTEFMSRTH
RVEVTPAVRTHTTTEPCRVCGIAPFGSDRYLVLACTLEEEGYMKELEVRIVDRTTFGNVF
RGRLHTKHKHPLQYSLAFSVGGVSTPAHAAASSYTVEKSVSATSRVAPTSLPSSMPLLSD
TVPAFVFFIVCVDAIIKVTPTDDDQHVEYLLRVGRFKEAYSYARTHPLRQHQAVDVGHQL
LQHLFAEKKYDEVASSLAEVVKEDYLEWERWICQFDQQGMSDLLVDVLPIQGGNSREIKG
DTEDGQEKVTRIGEEYYELVLLRCLEKNVFLFQRAVRKFKGMFRPDVVSHAAELRYNDGD
MQGNVGGVPDEQKKALGDTYGLLLKLGGQYDRAFEVLLRVDQSDELFSLIREQKLFLKAL
EALPALFARNEDRTIELLLEHIYARSAVADQEEATEALPLRSFLTPAAVVQRLERTQRRY
LWAYLKALQTRDKAVHAALSETHAQLFATLFIENEPSGLFAFLHENSAHLPKLREIYALC
KKHQLLEEMVFLLARMGKEEEGLRIIVHEMKSMKKAVQFIADVPNEEDQLHLYKRLVHMT
LEMNTALQSRHGQKYFEYRPTEGETWASIARKYDIDEGELRMANGAGNPLPGGVSSSSSS
SGRVAPISNLCIVPLNITGALLRAIVDPSISGRVALDPTYVVELLPEDEPMPHVGSRIAN
VARSKANDVWLMTAVVHVATSDLGKHYETLYRRRGAAIRVDPRMAVCPFCHQPTLADVVI
FGCSHTYHANCVIGYLAGEGVLLVQPADVDVGRFFKHPEEYLRPGSRKVSPRCLVCCEVR
GAVK
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atggacttacatgatccttctgaggaaataaatcagcagagcgaaggcgaggatgacaaa
gggtacgaggaggtgattgaggagatggaggtggaagaggagtcatatattagtgggtcg
tacgaagaagcatacgatgaggaaatgaccgatgacgaggaggaggaggaacagaaggaa
gaccaggagaatcttctctcattttcaacatttccgctggaagcgttacgcggccagcac
attatggtggcggtggcgttcaatcggttcattgttattggcaccaatcgtggtgtggtg
gcattggtggaggggtctggtgtggtgcttcgcatgctcaacaatcacatcgaccccatt
agtgacgtgagctgcgacattatggaggagcatgtgggttcctccgacaaggcgggtgtt
gttactgtgcagaacctgagtgacgagcaagatttttatcgaagggagtttgatgttcca
atttattcaatggcacttcatccaaaatacagccgcagtgaagatcgagccattcttttg
ggtggcggtgataaagtgatgctcattacaaaaacgagaattttaggccaccgaaaaatc
accattttgcaggagcggcgtggaaaggtttacgcggtacgctggtgtggccccgagttg
attgcctgggcaaatgatcgtggtgtgcagctctatagttatactggacgggcgatggtg
cattttgtatctagacccgtggactcatcaagactggagttttaccgctgctccctcgtg
tgggaggcccctcgtacacttacctgtggatggggagactgggttcaggtgcttcacgtc
tacgagctacggatggaggaacggttgagatggggaacggaattcatgtcgaggacgcat
cgagtggaagtcacgccggctgttcgaacgcacacaacaacggaaccatgtcgtgtatgt
ggtatcgctccatttggttcagaccgataccttgtgcttgcttgcactcttgaggaagaa
ggctatatgaaggaactagaggtgcgtattgtggatcgtaccacgtttggtaatgtattt
cgtggacgcctacatacaaaacacaagcatcccttgcagtacagtttagccttttctgtt
ggtggagttagcactcctgctcatgctgctgcttcttcttatacggtggagaagtcggtg
tcggcgacatccagggtagcacccacatcgttgccttcctcgatgccattgttgtctgac
accgtgccggcatttgttttttttattgtttgcgtggatgccatcattaaggtgacaccc
accgacgacgaccagcatgtggagtatcttctaagggtgggtcgtttcaaagaggcctac
agctacgcccgcacccacccgctccgtcagcatcaagctgtggacgttggccatcagctc
ctgcagcatctgtttgcggagaagaagtacgacgaggtggcgtcttcgttggcggaggtg
gtgaaggaggattatttggagtgggagcggtggatttgtcagttcgatcagcagggcatg
tccgatctgcttgttgatgtgcttccgattcagggcggaaatagcagggagataaaaggt
gacacggaagatggtcaggagaaggtcaccagaattggagaagagtactatgagcttgtg
ctacttcggtgtctagagaagaatgtctttctctttcaaagagctgtgcggaaatttaag
ggcatgtttcggccggatgtggtgagtcacgctgccgaattgcgctataacgatggagac
atgcagggcaatgtgggcggggtacccgacgaacaaaaaaaagctcttggagacacgtat
gggttgctgctaaaacttggtggtcaatatgacagggcattcgaggttttgctacgggtg
gatcaaagtgatgagctcttcagtcttatacgggaacagaaactctttttgaaagcattg
gaggccttgcctgcgctgttcgccaggaacgaggacaggaccatcgagctcctcctggaa
cacatttacgcgagaagcgctgttgcggatcaggaagaagcaacagaggcgttgccgttg
cgatcgtttctcacaccggcggccgtcgtgcaacgattggaacggacgcagcgtcgttat
ctgtgggcatacctgaaggcgttgcagacccgagacaaggcagtgcacgccgcgctgtcg
gagacgcatgcgcaactctttgcgacgctttttattgagaacgagccgtctggtttgttt
gcgttcctgcatgagaattccgcgcaccttcccaagctaagggagatatatgcactgtgc
aaaaaacaccagctcctggaggagatggttttcctgcttgcgaggatgggaaaagaggag
gagggccttcgaatcattgtgcacgaaatgaaaagcatgaagaaggcggtgcagtttatt
gccgatgttcccaacgaggaggatcagcttcacctctacaaaagacttgtgcacatgact
ctcgagatgaacaccgcacttcagagccgtcatggacagaagtactttgagtaccgcccg
acggagggtgaaacgtgggcaagcatagccaggaagtatgacatcgacgagggtgagcta
cgcatggctaacggcgctgggaatccacttcctggcggagtcagcagcagcagcagcagc
agcggtcgcgtggctccgataagcaacctttgcattgtacctctaaacatcacgggggca
cttttgcgggccattgtggatccatccataagcggacgcgttgcgttggatcccacgtac
gttgttgagctactgccagaggacgagcccatgccacatgtgggaagccgcattgccaac
gtggcgcgcagcaaggcaaatgatgtgtggctcatgacggccgtcgtgcacgtggcgacg
agtgacttggggaagcactacgagacgctgtacaggcggcggggggcggcaattcgtgtg
gaccctcgaatggcggtgtgccccttttgccaccagccaacgttggcggacgttgtgatc
tttgggtgctcccacacctaccacgccaactgtgtgattggctacctcgctggcgagggt
gttctgctcgtgcagccagccgatgttgatgttggccgctttttcaagcacccggaggaa
tacctgaggccgggctcgcggaaggtgtcgcctcgctgccttgtctgttgtgaggtgcgc
ggggcagtgaaataa

DBGET integrated database retrieval system