KEGG   Trypanosoma cruzi: 508153.130Help
Entry
508153.130        CDS       T01012                                 

Definition
(RefSeq) enoyl-CoA hydratase, mitochondrial precursor
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tcr  Trypanosoma cruzi
Pathway
tcr00062  Fatty acid elongation
tcr00071  Fatty acid degradation
tcr00280  Valine, leucine and isoleucine degradation
tcr00310  Lysine degradation
tcr00380  Tryptophan metabolism
tcr00410  beta-Alanine metabolism
tcr00640  Propanoate metabolism
tcr00650  Butanoate metabolism
tcr01100  Metabolic pathways
tcr01110  Biosynthesis of secondary metabolites
tcr01130  Biosynthesis of antibiotics
tcr01200  Carbon metabolism
tcr01212  Fatty acid metabolism
Module
tcr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    508153.130
   00650 Butanoate metabolism
    508153.130
  Lipid metabolism
   00062 Fatty acid elongation
    508153.130
   00071 Fatty acid degradation
    508153.130
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    508153.130
   00310 Lysine degradation
    508153.130
   00380 Tryptophan metabolism
    508153.130
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    508153.130
Enzymes [BR:tcr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     508153.130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 3555108
NCBI-ProteinID: XP_822044
GeneDB: Tc00.1047053508153.130
UniProt: Q4E679
AA seq 267 aa AA seqDB search
MLRKSLFLLNSMDPIVKYAQKGAVVTLTLNRPKQLNALNAELTNALAEKLLKCDADPSVS
VLIITGEGRSFVAGADIKAMANQTFVEFYKHNMLRGLDTIAAVRKPIIAAVNGFALGGGC
ELAMSCDIVVASEKAIFGQPEIKIGTIPGAGGTQRLTRLIGKSKAMEWILTGEQYTAEEA
ERAGLVSRVVRHEELLPTVSAMAEKIALNSPLAVSLAKDCINKALETTLAQGMAYEQRTF
QATFATDDQKEGMAAFVEKRKPNFKNA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcaagagtctgttccttcttaattccatggaccctattgtcaagtacgcccaa
aagggtgctgtggtgacattgacgttaaatcgtcctaaacagctcaatgccctgaatgcg
gagttaacaaatgcactggcggaaaagctgctaaagtgtgacgccgatccatcggtctct
gttttgatcatcactggtgaaggccgatcctttgttgctggcgcagacatcaaagcaatg
gcaaaccaaacttttgtcgaattttacaaacacaacatgcttcgaggccttgatacgatt
gcagcggtccgcaaacccattatcgccgcggtaaacggtttcgcactcggtggcggctgt
gagttggcgatgtcttgcgacattgttgttgccagcgaaaaggccatctttgggcaaccc
gagatcaaaattggaacaattccgggcgcgggtgggacgcagcgactcacacgactcatt
ggtaagagcaaagcaatggaatggattcttacaggtgagcaatacacggccgaggaggct
gaacgcgccgggttggtttcacgcgtcgttaggcatgaggaacttcttccaacggtcagt
gcaatggcagaaaaaatcgccctgaacagcccattagctgtttctttggccaaagactgc
atcaacaaggcattggagacaacgctggcgcaaggtatggcctatgagcagcgcaccttt
caagccacctttgccacggatgatcagaaggagggcatggctgcgtttgtggagaagcgc
aagccgaattttaagaatgcgtga

DBGET integrated database retrieval system